IP Library › Granted Patent US 12,194,075
Granted Patent B2
US 12,194,075 · App. 17/028,377 · Granted Jan 14, 2025

Computational design of self-assembling cyclic protein homo-oligomers

Inventors: David Baker (Seattle, WA); Jorge Fallas (Seattle, WA); George Ueda (Seattle, WA); William H. Sheffler (Seattle, WA); Vanessa Nguyen (Seattle, WA)
Assignee: UNIVERSITY OF WASHINGTON
A61K38/03C07K14/00G16B5/00G16B15/30
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,194,075
App. No.
17/028,377
Granted
Jan 14, 2025
Kind
B2
Abstract

Described herein are polypeptides capable of self-assembling to form homo-oligomers, and methods for designing such polypeptides.

Claims (34)

1. A nucleic acid encoding a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 40,

wherein the polypeptide is capable of self-assembly into homo-oligomers; and

wherein residues in bold font for SEQ ID NO: 40 are conserved in the polypeptide:

EEAELAYLLGELAYKLGEYRIAIRAYRIALKRDPNNAEAWYNLGNAYYKOGRYREAIEYYQKA LELDPNNAEAWYNLGNAYYERGEYEEAIEYYRKALRLDPNNADAMONLLNAKMREE (SEQ ID NO: 40).

2. The nucleic acid of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 75% sequence identity to the amino acid sequence of SEQ ID NO: 40.

3. The nucleic acid of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 40.

4. The nucleic acid of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 40.

5. The nucleic acid of claim 1 , wherein the polypeptide comprises the amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 40.

6. A nucleic acid encoding a polypeptide capable of self-assembly into homo-oligomers, wherein the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 16-21, 34-35, 37, and 40.

7. The nucleic acid of claim 1 , wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 40.

8. An expression vector, comprising the nucleic acid of claim 1 operatively linked to a promoter.

9. A host cell comprising the expression vector of claim 8 .

10. A kit, comprising:

(a) the nucleic acid of claim 1 ; and

(b) a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39.

11. A kit, comprising:

(a) the expression vector of claim 9 ; and

(b) a second expression vector comprising a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39, wherein the second nucleic acid is operatively linked to a promoter.

12. An expression vector, comprising the nucleic acid of claim 6 operatively linked to a promoter.

13. A host cell comprising the expression vector of claim 12 .

14. A kit, comprising:

(a) the nucleic acid of claim 6 ; and

(b) a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39.

15. A kit, comprising:

(a) the expression vector of claim 12 ; and

(b) a second expression vector comprising a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39, wherein the second nucleic acid is operatively linked to a promoter.

16. An expression vector, comprising the nucleic acid of claim 7 operatively linked to a promoter.

17. A host cell comprising the expression vector of claim 16 .

18. A kit, comprising:

(a) the nucleic acid of claim 7 ; and

(b) a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39.

19. A kit, comprising:

(a) the expression vector of claim 16 ; and

(b) a second expression vector comprising a second nucleic acid that encodes a polypeptide comprising the amino acid sequence that has at least 70% sequence identity to the amino acid sequence of SEQ ID NO:39, wherein the second nucleic acid is operatively linked to a promoter.

Assignments (3)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 25, 2023
From: HOWARD HUGHES MEDICAL INSTITUTE
To: UNIVERSITY OF WASHINGTON
Reel/Frame 064381/0480 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded May 17, 2023
From: BAKER, DAVID
To: HOWARD HUGHES MEDICAL INSTITUTE
Reel/Frame 063678/0175 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Sep 23, 2020
From: FALLAS, JORGE; UEDA, GEORGE; SHEFFLER, WILLIAM H.; NGUYEN, VANESSA
To: UNIVERSITY OF WASHINGTON
Reel/Frame 053862/0868 →
Continuity (3)
Continuation 15813872 · Nov 15, 2017
Provisional Application 62422872 · Nov 16, 2016
Related Publication 20210183465A1 · Jun 17, 2021
References Cited (64)
US 7479536B1 · Kumar et al. · 2009 [cited by applicant]
US 7683025B2 · Stupp et al. · 2010 [cited by applicant]
US 20010049357A1 · De et al. · 2001 [cited by applicant]
US 20050209145A1 · Stupp et al. · 2005 [cited by applicant]
US 20130071418A1 · Schein et al. · 2013 [cited by applicant]
US 20190309286A1 · Itzhaki et al. · 2019 [cited by applicant]
Englander, S. Walter, and Leland Mayne. “The nature of protein folding pathways.” Proceedings of the National Academy of Sciences 111.45 (2014): 15873-15880. (Year: 2014). [cited by examiner]
Buch, Idit, et al. “Self-Assembly of Fused Homo-Oligomers to Create Nanotubes.” Nanostructure Design: Methods and Protocols (2008): 117-131. (Year: 2008). [cited by examiner]
Adams, P. D. et al. PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallographica Section D-Biological Crystallography 66, 213-221, doi: 10.1107/s0907444909052925 (2010). [cited by applicant]
Ali, M.H. and Imperiali, B., 2005. Protein oligomerization: how and why. Bioorganic & medicinal chemistry, 13(17), pp. 5013-5020. [cited by applicant]
Arnout R. D. Voet, H. N., Christine Addy, David Simoncini, Daiki Terada, Satoru Unzai,Sam-Yong Park, Kam Y. J. Zhang, and Jeremy R. H. Tame. Computational design of a self-assembling symmetrical β-propeller protein. PNA… [cited by applicant]
Bahadur, R. P., Chakrabarti, P., Rodier, F. & Janin, J. Dissecting subunit interfaces in homodimeric proteins. Proteins 53, 708-719 (2003). [cited by applicant]
Bahadur, R.P., Chakrabarti, P., Rodier, F. & Janin, J. A dissection of specific and non-specific protein-protein interfaces. J. Mol. Biol. 336, 943-955 (2004). [cited by applicant]
Battye, T. G. G., Kontogiannis, L., Johnson, O., Powell, H. R. & Leslie, A. G. W. iMOSFLM: a new graphical interface for diffraction-image processing with MOSFLM. 36 Acta Crystallographica Section D-Biological Crystallo… [cited by applicant]
Boyken, S. E. et al. De novo design of protein homo-oligomers with modular hydrogen-bond network-mediated specificity. Science 352, 680-687 (2016). [cited by applicant]
Brunette, T. J. et al. Exploring the repeat protein universe through computational protein design. Nature 528 580-584 (2015). [cited by applicant]
Chen, R. & Weng, Z. P. Docking unbound proteins using shape complementarity, desolvation, and electrostatics. Proteins 47, 281-294 (2002). [cited by applicant]
Chenna, R. et al. Multiple sequence alignment with the Clustal series of programs. Nucleic Acids Research 31, 3497-3500, doi:10.1093/nar/gkg500 (2003). [cited by applicant]
Davis, I. W. et al. MolProbity: all-atom contacts and structure validation for proteins and nucleic acids. Nucleic Acids Research 35, W375-W383, doi: 10.1093/nar/gkm216 (2007). [cited by applicant]
DeBartolo, J., Dutta, S., Reich, L. & Keating, A. E. Predictive Bcl-2 family binding models rooted in experiment or structure. J. Mol. Biol. 422, 124-144 (2012). [cited by applicant]
Der, B. S. et al. Metal-mediated affinity and orientation specificity in a computationally designed protein homodimer. J. Am. Chem. Soc. 134, 375-385 (2012). [cited by applicant]
Dyer, K. N. et al. High-Throughput SAXS for the Characterization of Biomolecules in Solution: A Practical Approach. Structural Genomics: General Applications 1091, 245-258, doi: 10.1007/978-1-62703-691-7_18 (2014). [cited by applicant]
Emsley, P. & Cowtan, K. Coot: model-building tools for molecular graphics. Acta Crystallographica Section D-Biological Crystallography 60, 2126-2132, doi: 10.1107/s0907444904019158 (2004). [cited by applicant]
Fleishman, S. J. et al. RosettaScripts: a scripting language interface to the Rosetta macromolecular modeling suite. PLoS One 6, e20161 (2011). [cited by applicant]
Fletcher, J. M. et al. A basis set of de novo coiled-coil peptide oligomers for rational protein design and synthetic biology. ACS Synth. Biol. 1, 240-250 (2012). [cited by applicant]
Goodsell, D. S. & Olson, A. J. Structural symmetry and protein function. Annu. Rev. Biophys. Biomol. Struct. 29, 105-153 (2000). [cited by applicant]
Gray, J. J. & Baker, D. Protein-protein docking predictions with RosettaDock. Biophys. J. 86, 306A-306A (2004). [cited by applicant]
Gray, J. J. et al. Protein-protein docking with simultaneous optimization of rigid-body displacement and side-chain conformations. J. Mol. Biol. 331, 281-299 (2003). [cited by applicant]
Huang, P. S. et al. De novo design of an ideal TIM-barrel scaffold. Protein Sci. 24, 186-186 (2015). [cited by applicant]
Huang, P.-S. et al. High thermodynamic stability of parametrically designed helical bundles. Science 346, 481-485 (2014). [cited by applicant]
Janin, J., Bahadur, R. P. & Chakrabarti, P. Protein-protein interaction and quaternary structure. Q. Rev. Biophys. 41, 133-180 (2008). [cited by applicant]
Kabsch, W. XDS. Acta Crystallographica Section D-Biological Crystallography 66, 125-132, doi:10.1107/s0907444909047337 (2010). [cited by applicant]
Koga, N. et al. Principles for designing ideal protein structures. Nature 491, 222-227 (2012). [cited by applicant]
Leaver-Fay, A. et al. In Methods in Enzymology, vol. 487: Computer Methods, Pt C Methods in Enzymology (eds M. L. Johnson & L. Brand) 545-574 (Elsevier Academic Press Inc, 2011). [cited by applicant]
Levy, E. D. & Teichmann, S. in Oligomerization in Health and Disease (eds Giraldo, J. & Ciruela, F.) 25-51 (Progress in Molecular Biology and Translational Science 117, 2013). [cited by applicant]
Levy, E.D. and Teichmann, S., 2013. Structural, evolutionary, and assembly principles of protein oligomerization. Prog Mol Biol Transl Sci, 117, pp. 25-51. [cited by applicant]
Lin, Y.-R. et al. Control over overall shape and size in de novo designed proteins. Proc. Natl Acad. Sci. USA 112, E5478-E5485 (2015). [cited by applicant]
Lu, M., Dousis, A. D. & Ma, J. OPUS-PSP: an orientation-dependent statistical all-atom potential derived from side-chain packing. J. Mol. Biol. 376, 288-301 (2008). [cited by applicant]
Main, E. R. G., Xiong, Y., Cocco, M. J., D'Andrea, L. & Regan, L. Design of stable alpha-helical arrays from an idealized TPR motif. Structure 11, 497-508 (2003). [cited by applicant]
McCoy, A. J. et al. Phaser crystallographic software. Journal of Applied Crystallography 40, 658-674, doi:10.1107/s0021889807021206 (2007). [cited by applicant]
Menard, M. Blais, J.C., Hamon, L, Valéry, JM, and Xie, J. The Journal of organic chemistry 2005 vol 70. / Issue 11 p. 4423-4430. Synthesis of orthogonally protected cyclic homooligomers from sugar amino acids. [cited by applicant]
Miles, et al. George Mason University. Geometry-based Computation of Symmetric Homooligomeric Protein Complexes, printed Mar. 2019. [cited by applicant]
Mou, Y., Huang, P. S., Hsu, F. C., Huang, S. J. & Mayo, S. L. Computational design and experimental verification of a symmetric protein homodimer. Proc. Natl Acad. Sci. USA 112, 10714-10719 (2015). [cited by applicant]
Nishi, H., Hashimoto, K., Madej, T. and Panchenko, A.R., 2013. Evolutionary, physicochemical, and functional mechanisms of protein homooligomerization. Progress in molecular biology and translational science, 117, p. 3. [cited by applicant]
Otwinowski, Z. & Minor, W. Processing of X-ray diffraction data collected in oscillation mode. Macromolecular Crystallography, Pt A 276, 307-326, doi: 10.1016/s0076-6879(97)76066-x (1997). [cited by applicant]
Park, K. et al. Control of repeat-protein curvature by computational protein design. Nat. Struct. Mol. Biol. 22, 167-174 (2015). [cited by applicant]
Parmeggiani, F. et al. A general computational approach for repeat protein design. J. Mol. Biol. 427, 563-575 (2015). [cited by applicant]
Pechmann, S., Levy, E. D., Tartaglia, G. G. & Vendruscolo, M. Physicochemical principles that regulate the competition between functional and dysfunctional association of proteins. Proc. Natl Acad. Sci. USA 106, 10159-1… [cited by applicant]
Pierce, B., Tong, W. W. & Weng, Z. P. M-ZDOCK: a grid-based approach for Cn symmetric multimer docking. Bioinformatics 21, 1472-1478 (2005). [cited by applicant]
Schneidman-Duhovny, D., Hammel, M. & Sali, A. FoXS: a web server for rapid computation and fitting of SAXS profiles. Nucleic Acids Res. 38, W540-W544 (2010). [cited by applicant]
Schneidman-Duhovny, D., Inbar, Y., Nussinov, R. & Wolfson, H. J. Patchdock and symmDock: servers for rigid and symmetric docking. Nucleic Acids Res. 33,3 W363-W367 (2005). [cited by applicant]
Sinha, S. K., Sirota, E. B., Garoff, S. & Stanley, H. B. X-Ray and Neutronscattering From Rough Surfaces. Physical Review B 38, 2297-2311, doi:10.1103/PhysRevB.38.2297 (1988). [cited by applicant]
Smart, O. S. et al. Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER. Acta Crystallographica Section D-Biological Crystallography 68, 368-380, doi: 10.1107/s09074449… [cited by applicant]
Smock, R. G., Yadid, I., Dym, O., Clarke, J. & Tawfik, D. S. De novo evolutionary emergence of a symmetrical protein is shaped by folding constraints. Cell 164, 476-486 (2016). [cited by applicant]
Stranges, P. B., Machius, M., Miley, M. J., Tripathy, A. & Kuhlman, B. Computational design of a symmetric homodimer using β-strand assembly. Proc. Natl Acad. Sci. USA 108, 20562-20567 (2011). [cited by applicant]
Tyka, M. D. et al. Alternate States of Proteins Revealed by Detailed Energy Landscape Mapping. Journal of Molecular Biology 405, 607-618, doi:10.1016/j.jmb.2010.11.008 (2011). [cited by applicant]
Voet, A. R. D. et al. Computational design of a self-assembling symmetrical β-propeller protein. Proc. Natl Acad. Sci. USA 111, 15102-15107 (2014). [cited by applicant]
Wei, H. et al. Lysozyme-stabilized gold fluorescent cluster: synthesis and application as Hg2+ sensor. Analyst 135, 1406-1410 (2010). [cited by applicant]
Wyatt, P. J. Light-Scattering and the Absolute Characterization of Macromolecules. Analytica Chimica Acta 272, 1-40, doi:10.1016/0003-2670(93)80373-s (1993). [cited by applicant]
Zheng, W. H., Schafer, N. P., Davtyan, A., Papoian, G. A. & Wolynes, P. G. Predictive energy landscapes for protein-protein association. Proc. Natl Acad. Sci. USA 109, 19244-19249 (2012). [cited by applicant]
Zimm, B. H. Apparatus and Methods for Measurement and interpretation of the Angular Variation of Light Scattering. Journal of Chemical Physics 16, 1099-1116, doi:10.1063/1.1746740 (1948). [cited by applicant]
Sequence alignment (2020) p. 1. [cited by applicant]
Jones et al. (2004) The diploid genome sequence of Candida albicans, Proc. Natl. Acad. Sci. USA, vol. 101, pp. 7329-7334. [cited by applicant]
Gallagher et al. (1997) Structure and Organization of the Human Ankyrin-1 Gene, J. Bioi. Chem., vol. 272, No. 31, pp. 19220-19228. [cited by applicant]