Treatment and prevention of house dust mite allergies
The present invention relates to a fusion protein having formula (I) X 1 −Y−X 2 (I), wherein X 1 and X 2 comprise each four to six allergen fragments or variants thereof fused to each other, wherein said allergen fragments are derived from at least two allergens of the genus Dermatophagoides , and wherein Y is a carrier protein.
1. A fusion protein having formula (I)
X 1 −Y−X 2 (I),
wherein X 1 and X 2 comprise each four to eight allergen fragments or variants thereof fused to each other, wherein said allergen fragments are derived from at least two allergens of the genus Dermatophagoides , and wherein Y is a carrier protein,
wherein the at least two allergens are of Dermatophagoides pteronyssinus and/or Dermatophagoides farina, and selected from the group consisting of Der p 1, Der p 2, Der p 5, Der p 7, Der p 21 and Der p 23, wherein the fusion protein comprises at least one polypeptide having amino acid sequence selected from the group consisting of SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23, SEQ ID No. 24 and/or SEQ ID No. 25, wherein
a) the allergen fragment of Der p 1 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVA (SEQ ID No. 1), ATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQ (SEQ ID No. 2), HNGVVQESYYRYVAREQSCRRPNAQRFGISN (SEQ ID No. 3), VRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL (SEQ ID No. 4), TNASSINGNAPAEIDLRQMRTVTPIRMQGGSGSSWAFSGVA (SEQ ID No. 5), ATESAYLAYRNQSLDLAEQELVDSASQHGSHGDTIPRGIEYIQ (SEQ ID No. 6) and HNGVVQESYYRYVAREQSSRRPNAQRFGISN (SEQ ID No. 7), and/or
b) the allergen fragment of Der p 2 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of CHGSEPCIIHRGKPFQLEAVFEANQNSKTAK (SEQ ID No. 8), EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWIVPKIAPKSEN (SEQ ID No. 9), HGSEPSIIHRGKPFQLEAVFEANQNSKTAK (SEQ ID No. 10) and EVDVPGIDPNASHYMKSPLVKGQQYDIKYTWIVPKIAPKSEN (SEQ ID No. 11), and/or
c) the allergen fragment of Der p 5 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of DYQNEFDFLLMERIHEQIKKGELALFYLQ (SEQ ID No. 12) and EQYNLEMAKKSGDILERDLKKEEARVKKIEV (SEQ ID No. 13), and/or
d) the allergen fragment of Der p 7 consists of amino acid sequence being at least 90% identical to amino acid sequence DPIHYDKITEEINKAVDEAVAAIEKSETFD (SEQ ID No. 14), and/or
e) the allergen fragment of Der p 21 consists of amino acid sequence being at least 90% identical to amino acid sequence YNYEFALESIKLLIKKLDELAKKVKAVNPDEYY (SEQ ID No. 15), and/or
f) the allergen fragment of Der p 23 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of GYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT (SEQ ID No. 16) and GYFADPKDPHKFYISSNWEAVHKDSPGNTRWNEDEETST (SEQ ID No. 17), and/or
g) the allergen fragment of Der f 1 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVA (SEQ ID No. 38), ATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQ (SEQ ID No. 39), QNGVVEERSYPYVAREQQCRRPNSQHYGISN (SEQ ID No. 40) and VRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM (SEQ ID No. 41), and/or
h) the allergen fragment of Der f 2 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of HGSDPCIIHRGKPFNLEAIFDANQNTKTAK (SEQ ID No. 42) and EVDVPGIDTNACHYIKCPLVKGQQYDAKYTWNVPKIAPKSEN (SEQ ID No. 43), and/or
i) the allergen fragment of Der f 5 consists of an amino acid sequence being at least 90% identical to an amino acid sequence selected from the group consisting of DYQNEFDFLLMQRIHEQMRKGEEALLHLQ (SEQ ID No. 44) and ERYNVEIALKSNEILERDLKKEEQRVKKIEV (SEQ ID No. 45), and/or
j) the allergen fragment of Der f 7 consists of an amino acid sequence being at least 90% identical to amino acid sequence DPIHYDKITEEINKAIDDAIAAIEQSETID (SEQ ID No. 46), and/or
k) the allergen fragment of Der f 21 consists of an amino acid sequence being at least 90% identical to amino acid sequence YNFETA VSTIEILVKDLAELAKKVKAVKSDD (SEQ ID No. 47), and/or
l) the allergen fragment of Der f 23 consists of an amino acid sequence being at least 90% identical to amino acid sequence GYFADPKDPCKFYICSNWEAIHKSCPGNTRWNEKELTCT (SEQ ID No. 48).
2. The fusion protein according to claim 1 , wherein the at least two allergens are of Dermatophagoides pteronyssinus and Dermatophagoides farinae.
3. The fusion protein according to claim 1 , wherein the at least two allergens are of Dermatophagoides pteronyssinus and selected from the group consisting of Der p 1, Der p 2, Der p 5, Der p 7, Der p 21 and Der p 23.
4. The fusion protein according to claim 1 , wherein the allergen fragments of the at least two allergens consist of 25 to 50 amino acid residues.
5. The fusion protein according to claim 1 , wherein at least one, of the cysteine residues of the allergen fragments are substituted with serine, threonine, glycine, alanine, or leucine.
6. The fusion protein according to claim 1 , wherein the carrier protein is a surface polypeptide of a virus of a hepadnaviridae family or a fragment of the surface polypeptide.
7. The fusion protein according to claim 1 , wherein the fusion protein comprises amino acid sequence SEQ ID No. 27 or amino acid sequence SEQ ID No. 28.
8. A nucleic acid molecule encoding a fusion protein according to claim 1 .
9. A vector comprising a nucleic acid molecule according to claim 8 .
10. A host cell comprising a nucleic acid molecule according to claim 8 .
11. A pharmaceutical preparation comprising at least one fusion protein according to claim 1 .
12. The pharmaceutical preparation according to claim 11 , wherein two fusion proteins or nucleic acid molecules comprised in the preparation have a weight ratio of 1:10 to 10:1.
13. The pharmaceutical preparation according to claim 11 , wherein said preparation comprises a fusion protein comprising amino acid sequence SEQ ID No. 27 and/or a fusion protein comprising amino acid sequence SEQ ID No. 28 or a nucleic acid molecule encoding a fusion protein comprising amino acid sequence SEQ ID No. 27 and/or a fusion protein comprising amino acid sequence SEQ ID No. 28.
14. A method of treating or preventing an allergy in a subject caused by an allergen of a house dust mite, comprising administering to the subject the fusion protein according to claim 1 .
15. The fusion protein according to claim 1 , wherein the allergen fragments of the at least two allergens consist of 28 to 48 amino acid residues.
16. The fusion protein according to claim 1 , wherein the allergen fragments of the at least two allergens consist of 30 to 45 amino acid residues.
17. The fusion protein according to claim 1 , wherein at least two of the cysteine residues of the allergen fragments are substituted with serine, threonine, glycine, alanine, or leucine.
18. The fusion protein according to claim 1 , wherein at least three of the cysteine residues of the allergen fragments are substituted with serine, threonine, glycine, alanine, or leucine.
19. The fusion protein according to claim 1 , wherein all of the cysteine residues of the allergen fragments are substituted with serine, threonine, glycine, alanine, or leucine.
20. The pharmaceutical preparation according to claim 11 , wherein two fusion proteins or nucleic acid molecules comprised in the preparation have a weight ratio of 1:5 to 5:1.
21. The pharmaceutical preparation according to claim 11 , wherein two fusion proteins or nucleic acid molecules comprised in the preparation have a weight ratio of 2:1 to 1:2.
22. The pharmaceutical preparation according to claim 11 , wherein two fusion proteins or nucleic acid molecules comprised in the preparation have a weight ratio of 1:1.