COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY TARGETING FLT3, PD-1, AND/OR PD-L1
CAR cells targeting FLT3 antigens in combination with a secreted anti-PD-1 and anti-PD-L1 antibodies or anti-PD-1-anti-PD-L1 bispecific antibodies are described as a new method of cancer treatment. It is proposed that these combination therapies are safe and effective in patients and can be used to treat human tumors and cancer.
1 . An isolated nucleic acid or a vector comprising:
a. a polynucleotide encoding a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an FLT3 antibody; (b) a hinge domain; (c) a transmembrane domain; (d) and an intracellular domain; and
b. a polynucleotide encoding an antibody or antigen binding fragment thereof comprising an antigen binding domain that recognizes and binds PD-1 or PD-L1 or both PD-1 and PD-L1.
2 . The isolated nucleic acid or the vector of claim 1 , further comprising (e) a polynucleotide encoding a signaling domain.
3 . The isolated nucleic acid or the vector of claim 1 , wherein the CAR further comprises an inducible or a constitutively active element, optionally wherein the inducible or the constitutively active element controls the expression of a polynucleotide encoding an immunoregulatory molecule or a cytokine.
4 . (canceled)
5 . The isolated nucleic acid or the vector of claim 3 , wherein the immunoregulatory molecule or cytokine comprises one or more of B7.1, CCL19, CCL21, CD40L, CD137L, GITRL, GM-CSF, IL-12, IL-2, low-toxicity IL-2, IL-15, IL-18, IL-21, LEC, or OX40L, optionally wherein the immunoregulatory molecule or cytokine comprises one or more of the following: IL-12; GM-CSF; IL-12 and GM-CSF; IL-12 and one or more of IL-2 and low-toxicity IL-2; one or more of IL-2 and low-toxicity IL-2; IL-12 and IL-15; IL-15; IL-12 and IL-21; IL-21; IL-12 and B7.1; B7.1; IL-12 and OX40L; OX40L; IL-12 and CD40L; CD40L; IL-12 and GITRL; GITRL; IL-12 and IL-18; IL-18; one or more of IL-2 and low-toxicity IL-2 and one or more of CCL19, CCL21, and LEC; IL-15 and one or more of CCL19, CCL21, and LEC; IL-21 and one or more of CCL19, CCL21, and LEC; GM-CSF and one or more of CCL19, CCL21, and LEC; OX40L and one or more of CCL19, CCL21, and LEC; CD137L and one or more of CCL19, CCL21, and LEC; B7.1 and one or more of CCL19, CCL21, and LEC; CD40L and one or more of CCL19, CCL21, and LEC; or GITRL and one or more of CCL19, CCL21, and LEC.
6 . (canceled)
7 . The isolated nucleic acid or vector of claim 1 , wherein the hinge domain comprises a CD8 α hinge domain.
8 . The isolated nucleic acid or vector of claim 1 , wherein the transmembrane domain comprises a CD8a transmembrane domain
9 . The isolated nucleic acid or vector of claim 1 , wherein the costimulatory signaling region comprises a CD28 costimulatory signaling region or a 4-1BB costimulatory signaling region or both a CD28 costimulatory signaling region and a 4-1BB costimulatory signaling region.
10 . The isolated nucleic acid or the vector of claim 1 , wherein the CAR comprises: (a) an antigen binding domain of a FLT3 antibody; (b) a CD8 α hinge domain; (c) a CD8 α transmembrane domain; and (d) a CD28 costimulatory signaling region or a 4-1BB costimulatory signaling region or both a CD28 costimulatory signaling region and a 4-1BB costimulatory signaling region.
11 . The isolated nucleic acid or the vector of claim 2 , wherein the CAR comprises: (a) an antigen binding domain of a FLT3 antibody; (b) a CD8 α hinge domain; (c) a CD8 α transmembrane domain; (d) a CD28 costimulatory signaling region or a 4-1BB costimulatory signaling region or both a CD28 costimulatory signaling region and a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain.
12 . The isolated nucleic acid or vector of claim 1 , wherein the antigen binding domain of the FLT3 antibody comprises a heavy chain variable region comprising:
a CDHR1 having the amino acid sequence (SYWMH (SEQ ID NO: 1)) or (NYGLH (SEQ ID NO: 2)) or an equivalent of each thereof,
a CDHR2 having the amino acid sequence (EIDPSDSYKDYNQKFKD (SEQ ID NO: 3)) or (VIWSGGSTDYNAAFIS (SEQ ID NO: 4)) or an equivalent of each thereof, and
a CDHR3 having the amino acid sequence (AITTTPFDF (SEQ ID NO: 5)) or (GGIYYANHYYAMDY (SEQ ID NO: 6)) or an equivalent of each thereof, and/or a light chain variable region comprising:
a CDLR1 having the amino acid sequence (RASQSISNNLH (SEQ ID NO: 7)) or (KSSQSLLNSGNQKNYM (SEQ ID NO: 8)) or an equivalent of each thereof,
a CDLR2 having the amino acid sequence (YASQSIS (SEQ ID NO: 9)) or (GASTRES (SEQ ID NO: 10)) or an equivalent of each thereof, and
a CDLR3 having the amino acid sequence (QQSNTWPYT (SEQ ID NO: 11)) or (QNDHSYPLT (SEQ ID NO: 12)) or an equivalent of each thereof.
13 . The isolated nucleic acid or vector of claim 1 , wherein the antigen binding domain that recognizes and binds PD-1 or PD-L1 or both PD-1 and PD-L1 comprises one or more of the following: a PD-1 antagonist and/or a PD-L1 antagonist, CDR regions of an antibody to PD-1 or PD-L1, a heavy chain and a light chain variable region of an antibody to PD-1 or PD-L1, a single chain variable fragment (scFv) comprising an antigen binding domain of a PD-1 antibody, a scFv comprising an antigen binding domain of a PD-L1 antibody, or an equivalent of each thereof.
14 - 16 . (canceled)
17 . The isolated nucleic acid or vector of claim 1 , wherein the antibody that recognizes and binds PD-1 or PD-L1 or both PD-1 and PD-L1 is a bispecific antibody,
optionally wherein the bispecific antibody comprises a PD-1 antagonist, a PD-L1 antagonist and an optional linker, or
wherein the bispecific antibody comprises CDR regions of an antibody to PD1, CDR regions of an antibody to PD-L1 and an optional linker, or
wherein the bispecific antibody comprises a heavy chain and light chain variable region of an antibody to PD1, a heavy chain and light chain variable region of an antibody to PD-L1 and an optional linker, or
wherein the bispecific antibody comprises an scFv comprising an antigen binding domain of an antibody to PD1, an scFv comprising an antigen binding domain of an antibody to PD-L1 and an optional linker.
18 - 21 . (canceled)
22 . The isolated nucleic acid or vector of claim 1 , wherein the vector is a plasmid or wherein the vector is a viral vector selected from a retroviral vector, a lentiviral vector, an adenoviral vector, or an adeno-associated viral vector, optionally wherein the vector is bicistronic or wherein the isolated nucleic acid or vector further comprises a promoter or enhancer operatively linked to the polynucleotide encoding the antibody or the antigen binding fragment that recognizes and binds PD-1 or PD-L1 or both PD-1 and PD-L1.
23 - 25 . (canceled)
26 . An isolated cell comprising the isolated nucleic acid or vector of claim 1 , wherein the cell is a prokaryotic cell or a eukaryotic cell selected from an animal cell, a mammalian cell, a bovine cell, a feline cell, a canine cell, a murine cell, an equine cell, a human cell, an immune cell, a T-cell, a B-cell, a NK-cell, a dendritic cell, a myeloid cell, a monocyte, or a macrophage, optionally wherein the eukaryotic cell has been activated.
27 - 32 . (canceled)
33 . An expanded population of cells of claim 26 .
34 . (canceled)
35 . An antibody or an antigen binding fragment thereof or a polypeptide comprising either or both of:
(i) a single chain variable fragment sequence (scFv) comprising an amino acid sequence of (Q V Q L V Q S G V E V K K P G A S V K V S C K A S G Y T F T N Y Y M Y W V R Q A P G Q G L E W M G G I N P S N G G T N F N E K F K N R V T L T T D S S T T T A Y M E L K S L Q F D D T A V Y Y C A R R D Y R F D M G F D Y W G Q G T T V T V S S G G G G S G G G G S G G G G S D I Q M T Q S P S S L S A S V G D R V T I T C R A S Q D V S T A V A W Y Q Q K P G K A P K L L I Y S A S F L Y S G V P S R F S G S G S G T D F T L T I S S L Q P E D F A T Y Y C Q Q Y L Y H P A T F G Q G T K V E I K R (SEQ ID NO: 13)) or an equivalent thereof, optionally encoded by the nucleotide sequence comprising a nucleic acid sequence
(CAGGTCCAATTGGTACAGAGCGGCGTCGAAGTAAAGAAGCCTGGAGCCAGCGTTA AAGTTTCTTGCAAGGCTTCAGGATATACTTTCACTAACTACTATATGTACTGGGTAC GGCAGGCTCCAGGGCAAGGGTTGGAGTGGATGGGAGGGATCAATCCTTCTAACGGC GGCACTAACTTTAACGAAAAATTTAAAAATAGGGTGACCCTCACAACTGACTCAAG TACGACTACAGCATACATGGAACTCAAATCTCTCCAATTCGATGACACGGCTGTCTA TTATTGCGCGAGAAGAGACTATCGCTTCGATATGGGGTTTGATTATTGGGGGCAAGG TACTACGGTTACCGTCAGCTCCGGGGGTGGCGGCTCCGGCGGCGGTGGGTCAGGTG GAGGAGGGTCTGACATTCAGATGACGCAATCCCCAAGCTCTCTGTCCGCGTCAGTGG GCGACCGAGTTACAATCACATGCCGCGCTTCTCAAGATGTGTCAACCGCTGTCGCCT GGTACCAACAGAAGCCTGGGAAGGCCCCTAAGCTTCTCATCTACTCAGCTTCTTTTC TGTACTCAGGGGTACCGTCTAGATTCTCAGGATCCGGTAGTGGGACGGACTTCACAT TGACCATAAGTTCCTTGCAGCCTGAGGATTTCGCTACATATTATTGCCAACAGTACC TTTACCATCCTGCCACTTTTGGCCAGGGTACTAAGGTCGAGATCAAACGG (SEQ ID NO: 14)), or an equivalent thereof, or
(ii) a scFv comprising an amino acid sequence
(EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIEWVRQAPGKGLEWVAWISPYGGST YYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVT VSAGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQ QKPGEAPRLLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTF GGGTKVEIK (SEQ ID NO: 15)) or an equivalent thereof, optionally encoded by the nucleotide sequence:
(GAAGTTCAGTTGGTCGAGTCAGGAGGAGGCCTGGTGCAACCCGGGGGCTCACTCCG GTTGTCCTGTGCTGCTTCAGGATTTACGTTTTCTGACTCATGGATACATTGGGTGCGC CAAGCCCCGGGCAAGGGGCTGGAATGGGTGGCCTGGATCTCTCCGTATGGGGGTTC CACCTACTATGCTGATTCAGTAAAAGGACGGTTCACTATAAGCGCGGATACAAGTA AGAATACTGCCTATCTTCAAATGAATTCTCTTCGCGCCGAGGATACAGCGGTATATT ATTGCGCTAGACGACATTGGCCAGGGGGCTTTGACTATTGGGGGCAGGGTACTCTTG TGACCGTTAGTGCGGGAGGTGGTGGCAGCGGTGGAGGCGGCTCCGGGGGTGGTGGT TCAGAAATTGTCCTGACTCAATCCCCTGCCACATTGAGTTTGAGCCCAGGAGAGAGA GCAACTCTGTCATGCCGGGCGTCAAAAGGTGTCAGTACGTCAGGCTACTCCTATCTT CATTGGTATCAGCAGAAACCGGGAGAAGCGCCGCGCCTTCTCATATACCTGGCTAGT TACCTTGAGAGTGGCGTCCCGGCCCGGTTTAGTGGGAGTGGGTCTGGGACTGATTTT ACGCTGACAATCAGCAGTCTTGAGCCAGAGGACTTCGCGGTTTACTATTGCCAACAT TCACGCGATTTGCCCCTCACCTTCGGCGGTGGAACGAAGGTTGAAATAAAA (SEQ ID NO: 16)), or an equivalent thereof.
36 - 58 . (canceled)
59 . A method of producing a CAR expressing cell comprising transducing an isolated cell with the isolated nucleic acid or the vector of claim 1 , and wherein the isolated cells are selected from: T-cells, B-cells, NK-cells, dendritic cells, myeloid cells, monocytes, or macrophages.
60 . (canceled)
61 . A method of inhibiting the growth of a cancer or tumor expressing FLT3, optionally acute myeloid leukemia (AML) in a subject, comprising contacting the cancer or tumor with the isolated cell of claim 26 .
62 . A method of inhibiting the growth of a cancer or tumor expressing FLT3 in a subject, optionally acute myeloid leukemia (AML), comprising measuring expression of PD-1 or PD-L1 or both PD-1 and PD-L1 in the subject and administering the isolated cell of claim 26 to a subject expressing PD-1 or PD-L1 or both PD-1 and PD-L1.
63 . A method of inhibiting the growth of a cancer or tumor in a subject, optionally acute myeloid leukemia (AML), comprising measuring expression of PD-1 or PD-L1 or both PD-1 and PD-L1 in the subject and administering the antibody or antigen binding fragment or polypeptide of claim 35 to a subject expressing PD-1 or PD-L1 or both PD-1 and PD-L1.
64 - 70 . (canceled)