IP Library › Granted Patent US 12,365,722

Granted Patent B2

US 12,365,722 · App. 17/285,956 · Granted Jul 22, 2025

Multispecific antibodies targeting multiple epitopes on the HIV-1 envelope

Inventors: Yuxing Li (Boyds, MD); James Steinhardt (Westminster, MD); Javier Guenaga (San Diego, CA); John R. Mascola (Rockville, MD); Tae-Wook Chun (North Bethesda, MD); Susan Moir (Washington, DC); Chi-I Chiang (Rockville, MD)

Assignees: University of Maryland, College Park; University of Maryland, Baltimore; The United States of America, as Represented by the Secretary, Department of Health and Human Servives; International AIDS Vaccine Initiative

C07K16/1063 A61K39/42 A61K45/06 A61P31/18 C07K16/1045 A61K2039/505 C07K2317/31 C07K2317/52 C07K2317/565 C07K2317/622 C07K2317/76 C07K2317/92

View Patent ↗

Loading inventors, assignments & file history…

Monitor This Case

Get email alerts when status or documents change.

Order Certified Copies

Most orders are placed with the USPTO same day — all within 24 business hours.

Order via The Patent Place →

Pre-filled with this patent's details

Quick Facts

Patent No.: US 12,365,722
App. No.: 17/285,956
Granted: Jul 22, 2025
Kind: B2

External Links

USPTO Patent Center↗ Full Patent PDF↗

Abstract

The present invention provides a multispecific anti-HIV antibody that binds to multiple epitopes on HIV envelope protein, wherein the antibody comprises: i. an amino acid sequence that binds to a V1/V2 apex glycan epitope; ii. an amino acid sequence that binds to a V3-base glycan region epitope; iii. an amino acid sequence that binds to a CD4 binding site (CD4bs) epitope; iv. an amino acid sequence that binds to a gp120/gp41 interface epitope; and v. an amino acid sequence that binds to a membrane proximal external region (MPER) epitope.

Claims (106)

1. A multispecific anti-HIV antibody that binds to multiple epitopes on HIV envelope protein, wherein the antibody comprises

i. amino acid sequences that bind to a V1/V2 apex glycan epitope selected from the group consisting of:

(a) an amino acid sequence comprising a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises QFRFDGYG (SEQ ID NO: 2), CDR H2 comprises ISHDGIKK (SEQ ID NO: 3) and CDR H3 comprises AKDLREDECEEWWSDDFGKQLPCAKSRGGLVGIADN (SEQ ID NO: 4); and an amino acid sequence comprising a CDR L1, CDR L2 and CDR L3, wherein CDR LI comprises TSNIGNNF (SEQ ID NO: 6), CDR L2 comprises ETD (SEQ ID NO:7) and CDR L3 comprises ATWAASLSSARV (SEQ ID NO: 8); and

(b) an amino acid sequence comprising a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises GNTLKTYD SEQ ID NO: 10), CDR H2 comprises ISHEGDKK (SEQ ID NO: 11) and CDR H3 comprises AKGSKHRLRDYALDDDGALNWAVDVDYLSNLEF (SEQ ID NO: 12); and

an amino acid sequence comprising a CDR LI, CDR L2 and CDR L3, wherein CDR LI comprises HSLIHGDRNNY (SEQ ID NO: 14), CDR L2 comprises LAS (SEQ ID NO: 15) and CDR L3 comprises MQGRESPWT (SEQ ID NO: 16);

ii. an amino acid sequence that binds to a V3-base glycan region epitope, wherein the amino acid comprises a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises GASISDSY (SEQ ID NO: 18), CDR H2 comprises VHKSGDT (SEQ ID NO:19) and CDR H3 comprises ARTLHGRRIYGIVAFNEWFTYFYMDV (SEQ ID NO: 20); and an amino acid sequence comprising a CDR L1, CDR L2 and CDR L3, wherein CDR L1 comprises SLGSRA (SEQ ID NO: 22), CDR L2 comprises NNQ (SEQ ID NO: 23) and CDR L3 comprises HIWDSRVPTKWV (SEQ ID NO: 24);

iii. an amino acid sequence that binds to a CD4 binding site (CD4bs) epitope wherein the amino acid comprises a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises GYTFTAHI (SEQ ID NO: 26), CDR H2 comprises IKPQYGAV (SEQ ID NO: 27) and CDR H3 comprises AR (SEQ ID NO: 28); and an amino acid sequence comprising a CDR LI, CDR L2 and CDR L3, wherein CDR LI comprises QGVGSD (SEQ ID NO: 30), CDR L2 comprises HTS (SEQ ID NO: 31) and CDR L3 comprises QVLQF (SEQ ID NO: 32);

iv. an amino acid sequence that binds to a gp120/gp41 interface epitope wherein the amino acid sequence comprises a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises GYRFNFYH (SEQ ID NO: 34), CDR H2 comprises ISPYSGDK (SEQ ID NO: 35) and CDR H3 comprises DDTGTYFCAKGLLRDGSSTWLPYL (SEQ ID NO: 36); and an amino acid sequence comprising a CDR L1, CDR L2 and CDR L3, wherein CDR L1 comprises NSVCCSHKS (SEQ ID NO: 38), CDR L2 comprises EDN (SEQ ID NO: 39) and CDR L3 comprises CSYTHNSGCV (SEQ ID NO: 40); and

v. an amino acid sequence that binds to a membrane proximal external region (MPER) epitope wherein the amino acid sequence comprises a CDR H1, CDR H2 and CDR H3, wherein CDR H1 comprises GFDFDNAW (SEQ ID NO: 42), CDR H2 comprises ITGPGEGWSV (SEQ ID NO: 43) and CDR H3 comprises TGYYFCARTGKYYDFWSGYPPGEEYFQD (SEQ ID NO: 44); and an amino acid sequence comprising a CDR L1, CDR L2 and CDR L3, wherein CDR L1 comprises RGDSLRSHYAS (SEQ ID NO: 46), CDR L2 comprises GKNNRPS (SEQ ID NO: 47) and CDR L3 comprises SSRDKSGSRLSV (SEQ ID NO: 48).

2. The multispecific anti-HIV antibody of claim 1 , wherein the antibody simultaneously binds the multiple epitopes.

3. The multispecific anti-HIV antibody of claim 1 , wherein the amino acid sequences of i-v) are present on a single polypeptide chain.

4. The multispecific anti-HIV antibody of claim 1 , wherein the antibody is capable of neutralizing at least 99% of the HIV viruses or HIV pseudoviruses listed in Table 1 with an IC50 value of less than 50 μg/mL.

5. The multispecific anti-HIV antibody of claim 4 , wherein the antibody has an IC50 geomean of between less than or equal to 0.10 μg/ml and less than or equal to 0.006 μg/ml.

6. The multispecific anti-HIV antibody of claim 1 , wherein the amino acid sequences of parts i-v) comprise amino acid sequences of single chain fragment variable (ScFv) moieties, wherein each ScFv moiety comprises an amino acid sequence from a light chain variable region (VL) and an amino acid sequence from a heavy chain variable region (VH) of an antibody.

7. The multispecific anti-HIV antibody of claim 6 , wherein:

(i) one or more of the ScFv moieties is organized such that the VL is at the amino terminal end of the ScFv moiety and the VH is at the carboxy terminal end of the ScFv moiety;

(ii) one or more of the ScFv moieties is organized such that the VH is at the amino terminal end of the ScFv moiety and the VL is at the carboxy terminal end of thevScFv moiety; or

(iii) each ScFv moiety is organized such that the VL is at the amino terminal end of the ScFv moiety and the VH is at the carboxy terminal end of the ScFv moiety.

8. The multispecific anti-HIV antibody of claim 6 , wherein the VL and VH sequences are separated by one or more linking amino acids.

9. The multispecific anti-HIV antibody of claim 1 , wherein the antibody further comprises an Fc region of an immunoglobulin or a variant thereof.

10. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises a first and second polypeptide chain, wherein the first and second polypeptide chains each comprise

a. five ScFv moieties, wherein each ScFv moiety on a single chain recognizes an individual epitope, wherein each ScFv moiety comprises an amino acid sequence from a light chain variable region (VL) and an amino acid sequence from a heavy chain variable region (VH) of an antibody; and

b. an Fc region of an immunoglobulin or a variant thereof.

11. The multispecific anti-HIV antibody of claim 6 , wherein the ScFv moieties are separated on the polypeptide chain by one or more linking amino acids.

12. The multispecific anti-HIV antibody of claim 1 , wherein the amino acid sequences of parts i-v) of claim 1 are organized on a single polypeptide chain in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the V1/V2 apex glycan epitope;

ii. an amino acid sequence that binds to the V3-base glycan region epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the gp120/gp41 interface epitope; and

v. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope.

13. The multispecific anti-HIV antibody of claim 1 , wherein the amino acid sequences of parts i-v) of claim 1 are organized on a single polypeptide chain in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope;

ii. an amino acid sequence that binds to the gp120/gp41 interface epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the V3-base glycan region epitope; and

v. an amino acid sequence that binds to the V1/V2 apex glycan epitope.

14. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises a first and second polypeptide chain, wherein the amino acid sequences of parts i-v) of claim 1 are organized in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope;

ii. an amino acid sequence that binds to the gp120/gp41 interface epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the V3-base glycan region epitope;

v. an amino acid sequence that binds to the V1/V2 apex glycan epitope; and

vi. an Fc region of an immunoglobulin or a variant thereof.

15. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises a first and second polypeptide chain, wherein the amino acid sequences of parts i-v) of claim 1 are organized in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the V1/V2 apex glycan epitope;

ii. an amino acid sequence that binds to the V3-base glycan region epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the gp120/gp41 interface epitope;

v. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope; and

vi. an Fc region of an immunoglobulin or a variant thereof.

16. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises

1) A first polypeptide chain, wherein the amino acid sequences of parts i-v) of claim 1 are organized in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope;

ii. an amino acid sequence that binds to the gp120/gp41 interface epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the V3-base glycan region epitope;

v. an amino acid sequence that binds to the V1/V2 apex glycan epitope; and

vi. an Fc region of an immunoglobulin or a variant thereof; and

2) A second polypeptide chain, wherein the amino acid sequences of parts i-v) of claim 1 are organized in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to the V1/V2 apex glycan epitope;

ii. an amino acid sequence that binds to the V3-base glycan region epitope;

iii. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

iv. an amino acid sequence that binds to the gp120/gp41 interface epitope;

v. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope; and

vi. an Fc region of an immunoglobulin or a variant thereof.

17. The multispecific anti-HIV antibody of claim 1 , wherein:

i. the amino acid sequence that binds to the epitope of the V1/V2-glycan region comprises an amino acid sequence from an antibody selected from the group consisting of VRC26.25 and PGDM1400;

ii. the amino acid sequence that binds to the epitope of the V3-glycan region comprises an amino acid sequence from antibody PGT121;

iii. the amino acid sequence that binds to the epitope of the CD4-binding site (CD4bs) comprises an amino acid sequence from antibody N6;

iv. the amino acid sequence that binds to the epitope of the gp120/gp41 interface comprises an amino acid sequence from antibody 35022; and

v. the amino acid sequence that binds to the epitope of the membrane proximal external region (MPER) comprises an amino acid sequence from an antibody selected from the group consisting of 10E8v4, 10E8v4_S100cF, and 10E8v4_V5R S100cF.

18. The multispecific anti-HIV antibody of claim 17 , wherein

i. the amino acid sequence from the antibody VRC26.25 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:1; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO:5;

ii. the amino acid sequence from the antibody PGDM1400 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:9; and

the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO:13;

iii. the amino acid sequence from the antibody PGT121 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:17; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO:21;

iv. the amino acid sequence from the antibody N6 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:25; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO: 29;

v. the amino acid sequence from the antibody 35022 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:33; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO: 37;

vi. the amino acid sequence from the antibody 10E8v4 comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:41; and VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO: 45;

vii. the amino acid sequence from the antibody 10E8v4_S100cF comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:49; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO:45; and

viii. the amino acid sequence from the antibody 10E8v4_V5R_S100cF comprises the VH region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VH region comprises SEQ ID NO:51; and the VL region or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions, wherein the VL region comprises amino acids SEQ ID NO:45.

19. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises an IgG1 Fc region variant comprising mutations corresponding to M428L and N434S.

20. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises an immunoglobulin Fc region that has been modified to facilitate heterodimerization.

21. The multispecific anti-HIV antibody of claim 1 , wherein the antibody further comprises a sequence tag that facilitates purification of the antibody.

22. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises any of SEQ ID NOS: 72-80.

23. A pharmaceutical composition comprising an antibody of claim 1 and a pharmaceutically acceptable carrier.

24. A method for treating or preventing HIV infection in a subject, comprising administering to the subject an effective amount of the composition of claim 23 .

25. The method of claim 24 , wherein the composition is administered in combination with another therapy.

26. The method of claim 25 , wherein the therapy is an anti-retroviral therapy.

27. The multispecific anti-HIV antibody of claim 1 , wherein the amino acid sequences of parts i-v) of claim 1 are organized on a single polypeptide chain in the following order, from its N-terminus to its C-terminus:

i. an amino acid sequence that binds to a CD4 epitope;

ii. an amino acid sequence that binds to a V1/V2 apex glycan epitope;

iii. an amino acid sequence that binds to the V3-base glycan region epitope;

iv. an amino acid sequence that binds to the CD4 binding site (CD4bs) epitope;

v. an amino acid sequence that binds to the gp120/gp41 interface epitope; and

vi. an amino acid sequence that binds to the membrane proximal external region (MPER) epitope.

28. The multispecific anti-HIV antibody of claim 27 , wherein the amino acid sequence of (i) is derived from the variable domains of the anti-CD4 antibody dB4C7/UB-421.

29. The multispecific anti-HIV antibody of claim 1 , wherein the antibody comprises a first and second polypeptide chain, wherein the first polypeptide chain comprises a heavy chain variable region wherein the heavy chain variable region comprises;

i. an amino acid sequence that binds to a V1/V2 apex glycan epitope;

ii. an amino acid sequence that binds to a V3-base glycan region epitope; and

iii. an amino acid sequence that binds to a CD4 binding site (CD4bs) epitope;

and wherein the second polypeptide chain comprises a light chain variable region wherein the light chain variable region comprises:

i. an amino acid sequence that binds to a CD4 binding site (CD4bs) epitope;

ii. an amino acid sequence that binds to a gp120/gp41 interface epitope; and

iii. an amino acid sequence that binds to a membrane proximal external region (MPER) epitope.

30. The multi-specific anti-HIV antibody of claim 29 , wherein the Fc domain comprises a M428L/N434S (LS) mutation.

Assignments (3)

ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Aug 13, 2025

From: STEINHARDT, JAMES

To: UNIVERSITY OF MARYLAND, COLLEGE PARK

Reel/Frame 072007/0625 →

ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Aug 13, 2025

From: CHIANG, CHI-I

To: UNIVERSITY OF MARYLAND, COLLEGE PARK

Reel/Frame 072430/0600 →

CONFIRMATORY LICENSE Recorded Dec 4, 2023

From: UNIVERSITY OF MARYLAND BALTIMORE

To: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT

Reel/Frame 065771/0541 →

Continuity (3)

Provisional Application 62749510 · Oct 23, 2018

Provisional Application 62748228 · Oct 19, 2018

Related Publication 20220227845A1 · Jul 21, 2022

References Cited (64)

US 3720760A · Bennich · 1973 [cited by applicant]

US 4235871A · Papahadjopoulos et al. · 1980 [cited by applicant]

US 4501728A · Geho et al. · 1985 [cited by applicant]

US 4722848A · Paoletti et al. · 1988 [cited by applicant]

US 4816567A · Cabilly et al. · 1989 [cited by applicant]

US 4837028A · Allen · 1989 [cited by applicant]

US 4902505A · Pardridge et al. · 1990 [cited by applicant]

US 4957735A · Huang · 1990 [cited by applicant]

US 5004697A · Pardridge · 1991 [cited by applicant]

US 5019369A · Presant et al. · 1991 [cited by applicant]

US 5055303A · Riley, Jr. · 1991 [cited by applicant]

US 5188837A · Domb · 1993 [cited by applicant]

US 5254342A · Shen et al. · 1993 [cited by applicant]

US 5268164A · Kozarich et al. · 1993 [cited by applicant]

US 5271961A · Mathiowitz et al. · 1993 [cited by applicant]

US 5413797A · Khan et al. · 1995 [cited by applicant]

US 5506206A · Kozarich et al. · 1996 [cited by applicant]

US 5514670A · Friedman et al. · 1996 [cited by applicant]

US 5534496A · Lee et al. · 1996 [cited by applicant]

US 7501049B2 · Schmidt · 2009 [cited by applicant]

US 20150218257A1 · Chan-Hui et al. · 2015 [cited by applicant]

US 20180118816A1 · Keyt et al. · 2018 [cited by applicant]

WO 9005144A1 · 1990 [cited by applicant]

WO 2017093985A1 · 2017 [cited by applicant]

WO 2017133640A1 · 2017 [cited by applicant]

WO WO2018075564A1 · 2018 [cited by examiner]

International Search Report and Written Opinion issued by the Internatoinal Searching Authority on Jan. 29, 2020, corresponding to counterpart International Applicatoin No. PCT/US2019/057089; 8 total pages. [cited by applicant]

International Preliminary Report on Patentability issued by The International Bureau of WIPO corresponding to counterpart International Application No. PCT/US2019/057089 dated Apr. 14, 2021; 1 page. [cited by applicant]

Asokan M, et al., Bispecific Antibodies Targeting Different Epitopes on the HIV-1 Envelope Exhibit Broad and Potent Neutralization. J Virol 89, 12501-12512 (2015). [cited by applicant]

Bar KJ, et al. Effect of HIV Antibody VRC01 on Viral Rebound after Treatment Interruption. N Engl J Med 375, 2037-2050 (2016). [cited by applicant]

Barre-Sinoussi F, et al., Isolation of a T-lymphotropic retrovirus from a patient at risk for acquired immune deficiency syndrome (AIDS). Science 220:868-871 (1983). [cited by applicant]

Buchacher A, et al. Generation of human monoclonal antibodies against HIV-1 proteins; electrofusion and Epstein-Barr virus transformation for peripheral blood lymphocyte immortalization. AIDS Res Hum Retroviruses 10, 35… [cited by applicant]

Burton DR, et al., A large array of human monoclonal antibodies to type 1 human immunodeficiency ; virus from combinatorial libraries of asymptomatic seropositive individuals. Proc Natl Acad Sci U S A 88, 10134-10137 (1… [cited by applicant]

Burton DR, Mascola JR. Antibody responses to envelope glycoproteins in HIV-1 infection. Nat Immunol 16, 571-576 (2015). [cited by applicant]

Caskey M, et al. Antibody 10-1074 suppresses viremia in HIV-1-infected individuals. Nat Med 23, 185-191 (2017). [cited by applicant]

Caskey M, et al. Viraemia suppressed in HIV-1-infected humans by broadly neutralizing antibody 3BNC117. Nature 522, 487-491 (2015). [cited by applicant]

Doria-Rose NA, et al., HIV-1 neutralization coverage is improved by combining monoclonal antibodies that target independent epitopes. J Virol 86, 3393-3397 (2012). [cited by applicant]

Galimidi RP, et al. Intra-spike crosslinking overcomes antibody evasion by HIV-1. Cell 160, 433-446 (2015). [cited by applicant]

Gallo RC, et al., Frequent detection and isolation of cytopathic retroviruses (HTLV-111) from patients with AIDS and at risk for AIDS. Science 224:500-503 (1984). [cited by applicant]

Hu Q, et al., Recent advances of cocktail chemotherapy by combination drug delivery systems. Adv Drug Deliv Rev 98, 19-34 (2016). [cited by applicant]

Huang J, et al. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody. Nature 491, 406-412 (2012). [cited by applicant]

Huang Y, et al, Engineered Sispecific Antobidies with Exquisite HIV-1- Neutralizing Activity. Cell 165, 1621-1631 (2016). [cited by applicant]

Klein F, et al., HIV therapy by a combination of broadly neutralizing antibodies in humanized mice. Nature 192:118-122 (2012). [cited by applicant]

Kong R, et al. Improving neutralization potency and breadth by combining broadly reactive HIV-1 antibodies targeting major neutralization epitopes. J Virol 89, 2659-2671 (2015). [cited by applicant]

Kowalski M, et al., Functional regions of the envelope glycoprotein of human immunodeficiency virus type 1. Science 237:1351-1355 (1987). [cited by applicant]

Kwong PD, et al., Broadly neutralizing antibodies and the search for an HIV-1 vaccine: the end of the beginning. Nat Rev Immunol 13:693-701 (2013). [cited by applicant]

Ledgerwood JE, et al. Safety, pharmacokinetics and neutralization of the broadly neutralizing HIV-1 human monoclonal antibody VRC01 in healthy adults. ; Clin Exp Immunol 182, 289-301 (2015). [cited by applicant]

Lu M, et al., A trimeric structural domain of the HIV-1 transmembrane glycoprotein. Nat Struct Biol 2:1075-1082 (1995). [cited by applicant]

Lynch RM, et al. HIV-1 fitness cost associated with escape from the VRC01 class of CD4 binding site neutralizing antibodies. J Virol 89, 4201-4213 (2015). [cited by applicant]

Lynch RM, et al. Virologic effects of broadly neutralizing antibody VRC01 administration during chronic HIV-1 infection. Sci Transl Med 7, 319ra206 (2015). [cited by applicant]

Pietzsch J, et al. Human anti-HIV-neutralizing antibodies frequently target a conserved epitope essential for viral fitness. J Exp Med 207, 1995-2002 (2010). [cited by applicant]

Sather DN, et al., Broadly neutralizing antibodies developed by an HIV-positive elite neutralizer exact a replication fitness cost on the contemporaneous virus. J Virol 86, 12676-12685 (2012). [cited by applicant]

Scheid JF, et al. Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding. Science 333, 1633-1637 (2011). [cited by applicant]

Shingai M, et al., Antibody-mediated immunotherapy of macaques chronically infected with SHIV suppresses viraemia. Nature 503:277-280 (2013). [cited by applicant]

Tebit DM, et al., HIV diversity, recombination and disease progression: how does fitness “fit” into the puzzle? AIDS Rev 9, 75-87 (2007). [cited by applicant]

Walker LM, et al., Broad neutralization coverage of HIV by multiple highly potent antibodies. Nature 477, 466-470 (2011). [cited by applicant]

Wu X, et al. Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1. Science 329, 856-861 (2010). [cited by applicant]

Wyatt R, et al., The HIV-I envelope glycoproteins: fusogens, antigens, and immunogens. Science 280:1884-1888 (1998). [cited by applicant]

Kobayashi et al., “Tryptophan H33 plays an important role in pyrimidine (6-4) pyrimidone photoproduct binding by a high-affinity antibody,” Protein Engineering, 1999, vol. 12, No. 10; pp. 879-884. [cited by applicant]

Burks et al., “In Vitro Scanning Saturation Mutagenesis of an Antibody Binding Pocket,” Proc. Natl. Acad. Sci. USA, Jan. 1997, vol. 94; pp. 412-417. [cited by applicant]

Huston et al., “Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single Chain Fv Analogue Produced in [cited by applicant]

Holliger et al., ““Diabodies”: Small Bivalent and Bispecific Antibody Fragments,” Proc. Natl. Acad. Sci., USA, Jul. 1993, vol. 90; pp. 6444-6448. [cited by applicant]

Poljak, “Production and Structure of diabodies,” Structure, Dec. 15, 1994, vol. 2; pp. 1121-1123. [cited by applicant]

Shankarappa et al., “Consistent Viral Evolutionary Changes Associated with the Progression of Human Immunodeficiency Virus Type 1 Infection,” Journal of Virology, vol. 73, No. 12, Dec. 1999; pp. 10489-10502. [cited by applicant]