IP Library Granted Patent US 12,037,399
Granted Patent B2
US 12,037,399 · App. 17/495,712 · Granted Jul 16, 2024

Anti-Dectin-1 antibodies and methods of use thereof

Inventors: Panagiotis Fotakis (Foster City, CA); Andrew P. Ah Young-Chapon (South San Francisco, CA); Nenad Tomasevic (Foster City, CA); Ruo Shi Shi (San Mateo, CA); Xiaodi Deng (Foster City, CA)
Assignee: Dren Bio, Inc.
C07K16/2851A61P35/00C07K16/2887A61K2039/505C07K2317/31C07K2317/52C07K2317/56
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,037,399
App. No.
17/495,712
Granted
Jul 16, 2024
Kind
B2
Abstract

The present disclosure relates to antibodies that bind human Dectin-1, multispecific (e.g., bispecific) binding molecules, and methods of use and production related thereto.

Claims (132)

1. An antibody or antigen-binding fragment thereof that binds to human Dectin-1, wherein the antibody or fragment comprises a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein the VH domain comprises a CDR-H1 comprising the sequence GYTFTDYY (SEQ ID NO:1), a CDR-H2 comprising the sequence INPNSGDT (SEQ ID NO:2), and a CDR-H3 comprising the sequence ARNSGSYSFGY (SEQ ID NO:3), and wherein the VL domain comprises a CDR-L1 comprising the sequence QGISSW (SEQ ID NO:4), a CDR-L2 comprising the sequence GAS (SEQ ID NO:5), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6).

2. An antibody or antigen-binding fragment thereof that binds to human Dectin-1, wherein the antibody or fragment comprises a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein the VH domain comprises a CDR-H1, CDR-H2, and CDR-H3 from the VH domain sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7), and wherein the VL domain comprises a CDR-L1, CDR-L2, and CDR-L3 from the VL domain sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPS RFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8).

3. The antibody of claim 2 , wherein the VH domain comprises a CDR-H1 comprising the sequence DYYI (SEQ ID NO:88), a CDR-H2 comprising the sequence WINPNSGDTNYAQKFQG (SEQ ID NO:89), and a CDR-H3 comprising the sequence NSGSYSFGY (SEQ ID NO:90), and wherein the VL domain comprises a CDR-L1 comprising the sequence RASQGISSWLA (SEQ ID NO:91), a CDR-L2 comprising the sequence GASSLQS (SEQ ID NO:92), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6).

4. The antibody of claim 1 , wherein the VH domain comprises a sequence with at least 90% identity to the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7); and wherein the VL domain comprises a sequence with at least 90% identity to the sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPS RFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8).

5. The antibody of claim 4 , wherein the VH domain comprises the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7); and wherein the VL domain comprises the sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPS RFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8).

6. The antibody of claim 1 , wherein the antibody or fragment is a human antibody or fragment.

7. The antibody of claim 1 , wherein the antibody or fragment binds to human Dectin-1 expressed on the surface of a macrophage, monocyte, dendritic cell, and/or granulocyte.

8. The antibody of claim 1 , wherein the antigen-binding fragment is a Fab, Fab′, F(ab′)2, Fv, Fab′-SH, F(ab′)2, single chain antibody, or scFv fragment.

9. The antibody of claim 1 , wherein the antibody further comprises an Fc region.

10. The antibody of claim 1 , wherein the antibody or fragment is a multispecific antibody or fragment.

11. The antibody of claim 10 , wherein the antibody or fragment is a bispecific antibody, fragment, or diabody comprising a first antigen binding domain comprising the VH and VL domains that bind to human Dectin-1 and a second antigen binding domain comprising second VH and VL domains that bind to a target of interest.

12. The antibody of claim 11 , wherein the bispecific antibody comprises:

(a) a first IgG antibody comprising the first antigen binding domain covalently linked to a second IgG antibody comprising the second antigen binding domain;

(b) a first antibody arm comprising a first antibody heavy chain that comprises the VH domain of the first antigen binding domain and a first Fc region, and a second antibody arm comprising a second antibody heavy chain that comprises the VH domain of the second antigen binding domain and a second Fc region, wherein the first Fc region comprises one or more knob-forming mutations, and the second Fc region comprises one or more cognate hole-forming mutations; or

(c) a first antibody arm comprising a first antibody heavy chain that comprises the VH domain of the first antigen binding domain and a first Fc region, and a second antibody arm comprising a second antibody heavy chain that comprises the VH domain of the second antigen binding domain and a second Fc region, wherein the first Fc region comprises one or more hole-forming mutations, and the second Fc region comprises one or more cognate knob-forming mutations.

13. The antibody of claim 11 , wherein the bispecific antibody comprises a first antibody arm comprising a single chain variable fragment (scFv) comprising the VH and VL domains that bind to human Dectin-1 and a first Fc region, and a second antibody arm comprising an antibody heavy chain that comprises the VH domain of the second antigen binding domain in association with an antibody light chain that comprises the VL domain of the second antigen binding domain and a second Fc region connected to the VH domain of the second antigen binding domain.

14. The antibody of claim 13 , wherein the first Fc region comprises one or more knob-forming mutations, and the second Fc region comprises one or more cognate hole-forming mutations, or wherein the second Fc region comprises one or more knob-forming mutations, and the first Fc region comprises one or more cognate hole-forming mutations.

15. The antibody of claim 13 , wherein the first antibody arm comprises a first linker between the VH and VL domains, and a second linker between the VL domain and the first Fc region.

16. The antibody of claim 15 , wherein the first linker comprises one or more repeats of the sequence GGGGS (SEQ ID NO:26).

17. The antibody of claim 16 , wherein the first linker comprises the sequence GGGGSGGGGSGGGGS (SEQ ID NO:27) or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO:28).

18. The antibody of claim 15 , wherein the second linker comprises the sequence EPKRSDKTHTCPPC (SEQ ID NO:29) or SATHTCPPC (SEQ ID NO:30).

19. The antibody of claim 11 , wherein the bispecific antibody comprises:

(a) a first IgG antibody comprising the first antigen binding domain coupled to biotin or an avidin-binding derivative thereof, and a second IgG antibody comprising the second antigen binding domain coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, wherein the biotin or avidin-binding derivative thereof is bound to the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof; or

(b) a first IgG antibody comprising the first antigen binding domain coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and a second IgG antibody comprising the second antigen binding domain coupled to biotin or an avidin-binding derivative thereof, wherein the biotin or avidin-binding derivative thereof is bound to the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof.

20. The antibody of claim 11 , wherein the target of interest is a disease-causing agent.

21. The antibody of claim 20 , wherein the disease-causing agent is a bacterial cell, fungal cell, virus, senescent cell, tumor cell, protein aggregate, LDL particle, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

22. The antibody of claim 21 , wherein the target of interest is an antigen expressed on the surface of the bacterial cell, fungal cell, senescent cell, tumor cell, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

23. The antibody of claim 21 , wherein the target of interest is a surface antigen of the virus.

24. The antibody of claim 20 , wherein the target of interest is an antigen expressed on the surface of a cancer cell.

25. The antibody of claim 9 , wherein the antibody comprises two antibody heavy chains comprising human IgG1 Fc domains, and wherein each of the human IgG1 Fc domains comprises an amino acid substitution at one or more of positions 234, 235, and 237, according to EU numbering.

26. The antibody of claim 25 , wherein each of the antibody heavy chains comprises L234A, L235E, and G237A substitutions, according to EU numbering.

27. The antibody of claim 11 , wherein the antibody comprises two antibody heavy chains, and wherein only one of the antibody heavy chains comprises H435R and Y436F substitutions, according to EU numbering.

28. The antibody of claim 11 , wherein the antibody comprises two arms, wherein only one of the two antibody arms comprises a heavy chain comprising F126C and C220V substitutions and a light chain comprising S121C and C214V substitutions, according to EU numbering.

29. The antibody of claim 11 , wherein the bispecific antibody comprises two antibody heavy chains and two antibody light chains, wherein the VH domain of the first antibody heavy chain forms an antigen binding domain with the VL domain of the first antibody light chain, wherein the VH domain of the second antibody heavy chain forms an antigen binding domain with the VL domain of the second antibody light chain, wherein the first antibody heavy chain comprises F126C, C220V, and T366W substitutions, wherein the first antibody light chain comprises S121C and C214V substitutions, and wherein the second antibody heavy chain comprises T366S, L368A, Y407V, H435R, and Y436F substitutions, according to EU numbering.

30. The antibody of claim 29 , wherein the first and second antibody heavy chains further comprise L234A, L235E, and G237A substitutions, according to EU numbering.

31. The antibody of claim 11 , wherein the bispecific antibody comprises a first and a second antibody heavy chain, wherein the first and second antibody heavy chains comprise human IgG1 Fc domains.

32. The antibody of claim 11 , wherein the bispecific antibody comprises a first and a second antibody heavy chain, wherein at least one or two of the first and second antibody heavy chains is/are non-fucosylated.

33. A multispecific binding molecule, comprising:

(a) a first antibody or antigen-binding fragment thereof comprising a first antigen-binding domain, wherein the first antigen-binding domain binds to human Dectin-1, wherein the first antigen-binding domain comprises a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein the VH domain comprises a CDR-H1 comprising the sequence GYTFTDYY (SEQ ID NO:1), a CDR-H2 comprising the sequence INPNSGDT (SEQ ID NO:2), and a CDR-H3 comprising the sequence ARNSGSYSFGY (SEQ ID NO:3), and wherein the VL domain comprises a CDR-L1 comprising the sequence QGISSW (SEQ ID NO:4), a CDR-L2 comprising the sequence GAS (SEQ ID NO:5), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6); and

(b) a second antibody or antigen-binding fragment thereof comprising a second antigen-binding domain, wherein the second antigen binding domain binds to a target of interest.

34. The multispecific binding molecule of claim 33 , wherein the target of interest is a disease-causing agent.

35. The multispecific binding molecule of claim 34 , wherein the disease-causing agent is a bacterial cell, fungal cell, virus, senescent cell, tumor cell, protein aggregate, LDL particle, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

36. The multispecific binding molecule of claim 35 , wherein the target of interest is an antigen expressed on the surface of the bacterial cell, fungal cell, senescent cell, tumor cell, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

37. The multispecific binding molecule of claim 35 , wherein the target of interest is a surface antigen of the virus.

38. The multispecific binding molecule of claim 34 , wherein the target of interest is an antigen expressed on the surface of a cancer cell.

39. The multispecific binding molecule of claim 33 , wherein the VH domain comprises a sequence with at least 90% identity to the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7); and wherein the VL domain comprises a sequence with at least 90% identity to the sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPS RFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8).

40. The multispecific binding molecule of claim 39 , wherein the VH domain comprises the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7); and wherein the VL domain comprises the sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPS RFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8).

41. The multispecific binding molecule of claim 33 , wherein:

(a) the first antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the second antibody or fragment is coupled to biotin or an avidin-binding derivative thereof, wherein the first antibody or fragment is bound to the second antibody or fragment via an interaction between the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof and the biotin or avidin-binding derivative thereof;

(b) the second antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the first antibody or fragment is coupled to biotin or an avidin-binding derivative thereof, wherein the first antibody or fragment is bound to the second antibody or fragment via an interaction between the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof and the biotin or avidin-binding derivative thereof; or

(c) the multispecific binding molecule comprises a first IgG antibody comprising the first antigen binding domain covalently linked to a second IgG antibody comprising the second antigen binding domain.

42. The multispecific binding molecule of claim 33 , wherein the multispecific binding molecule comprises a first antibody arm comprising a single chain variable fragment (scFv) comprising the VH and VL domains that bind to human Dectin-1 and a first Fc region, and a second antibody arm comprising an antibody heavy chain that comprises the VH domain of the second antigen binding domain in association with an antibody light chain that comprises the VL domain of the second antigen binding domain and a second Fc region connected to the VH domain of the second antigen binding domain.

43. The multispecific binding molecule of claim 42 , wherein the first Fc region comprises one or more knob-forming mutations, and the second Fc region comprises one or more cognate hole-forming mutations, or wherein the second Fc region comprises one or more knob-forming mutations, and the first Fc region comprises one or more cognate hole-forming mutations.

44. The multispecific binding molecule of claim 42 , wherein the first antibody arm comprises a first linker between the VH and VL domains of the first antibody arm, and a second linker between the VL domain of the first antibody arm and the first Fc region.

45. The multispecific binding molecule of claim 44 , wherein the first linker comprises one or more repeats of the sequence GGGGS (SEQ ID NO:26).

46. The multispecific binding molecule of claim 45 , wherein the first linker comprises the sequence GGGGSGGGGSGGGGS (SEQ ID NO:27) or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO:28).

47. The multispecific binding molecule of claim 44 , wherein the second linker comprises the sequence EPKRSDKTHTCPPC (SEQ ID NO:29) or SATHTCPPC (SEQ ID NO:30).

48. The multispecific binding molecule of claim 33 , wherein the multispecific binding molecule comprises a first antibody arm comprising a first antibody heavy chain that comprises the VH domain of the first antigen binding domain and a first Fc region and a first antibody light chain comprising the VL domain of the first antigen binding domain, and a second antibody arm comprising a second antibody heavy chain that comprises the VH domain of the second antigen binding domain and a second Fc region and a second antibody light chain comprising the VL domain of the second antigen binding domain, wherein:

(a) the first Fc region comprises one or more knob-forming mutations, and the second Fc region comprises one or more cognate hole-forming mutations; or

(b) the first Fc region comprises one or more hole-forming mutations, and the second Fc region comprises one or more cognate knob-forming mutations.

49. The multispecific binding molecule of claim 43 , wherein:

(a) the first Fc region comprises a T366W substitution, and wherein the second Fc region comprises T366S, L368A, and Y407V substitutions, according to EU numbering; or

(b) wherein the first Fc region comprises T366S, L368A, and Y407V substitutions, and wherein the second Fc region comprises a T366W substitution, according to EU numbering.

50. The multispecific binding molecule of claim 42 , wherein the first and/or the second Fc region is a human IgG1 Fc region that comprises an amino acid substitution at one or more of positions 234, 235, and 237, according to EU numbering.

51. The multispecific binding molecule of claim 50 , wherein each of the first and second Fc regions comprises L234A, L235E, and G237A substitutions, according to EU numbering.

52. The multispecific binding molecule of claim 48 , wherein only one of the Fc regions comprises H435R and Y436F substitutions, according to EU numbering.

53. The multispecific binding molecule of claim 48 , wherein only one of the antibody arms comprises a heavy chain comprising F126C and C220V substitutions and a light chain comprising S121C and C214V substitutions, according to EU numbering.

54. The multispecific binding molecule of claim 33 , wherein the multispecific binding molecule comprises a first antibody heavy chain and a first antibody light chain and a second antibody heavy chain and a second antibody light chain, wherein the VH domain of the first antibody heavy chain forms a first antigen binding domain with the VL domain of the first antibody light chain, wherein the VH domain of the second antibody heavy chain forms a second antigen binding domain with the VL domain of the second antibody light chain, wherein the first antibody heavy chain comprises F126C, C220V, and T366W substitutions, wherein the first antibody light chain comprises S121C and C214V substitutions, and wherein the second antibody heavy chain comprises T366S, L368A, Y407V, H435R, and Y436F substitutions, according to EU numbering.

55. The multispecific binding molecule of claim 54 , wherein the first and second antibody heavy chains further comprise L234A, L235E, and G237A substitutions, according to EU numbering.

56. The multispecific binding molecule of claim 48 , wherein the first and second antibody heavy chains comprise human IgG1 Fc domains.

57. The multispecific binding molecule of claim 48 , wherein at least one or two of the first and second antibody heavy chains is/are non-fucosylated.

58. The multispecific binding molecule of claim 33 , wherein one or both of the first and second antibodies or fragments are humanized antibodies or fragments.

59. The multispecific binding molecule of claim 33 , wherein:

(a) one or both of the first and second antibodies or fragments are Fab, Fab′, F(ab′)2, Fv, Fab′-SH, F(ab′)2, single chain antibodies, or scFv fragments;

(b) one or both of the first and second antibodies further comprise an Fc domain;

(c) the first antibody or fragment is a Fab fragment, and the second antibody comprises an antibody heavy chain and an antibody light chain;

(d) the first and the second antibodies or fragments are both full-length antibodies;

(e) the first antibody or fragment is a Fab fragment coupled to monomeric streptavidin (mSA), and the second antibody is a biotinylated antibody that comprises an antibody heavy chain and an antibody light chain; or

(f) the first antibody or fragment is a full-length antibody coupled to monomeric streptavidin (mSA), and the second antibody or fragment is a biotinylated full-length antibody.

60. A multispecific binding molecule comprising a first arm comprising a first antigen-binding domain and a second arm comprising a second antigen-binding domain; wherein the first antigen-binding domain binds to human Dectin-1 and the second antigen-binding domain binds to a target of interest; and wherein the first arm comprises a polypeptide chain comprising the sequence

(SEQ ID NO: 31)

QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGW

INPNSGDTNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNS

GSYSFGYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSVS

ASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQSGVPSRF

SGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIEEPKRS

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED

PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK

CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVK

GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG

NVFSCSVMHEALHNHYTQKSLSLSPG.

61. A polynucleotide encoding the antibody of claim 1 .

62. A vector comprising the polynucleotide of claim 61 .

63. An isolated host cell comprising the polynucleotide of claim 61 .

64. The isolated host cell of claim 63 , wherein the host cell is a mammalian, yeast, insect, plant, or prokaryotic cell.

65. The isolated host cell of claim 64 , wherein the mammalian cell is a Chinese hamster ovary (CHO) cell.

66. The isolated host cell of claim 64 , wherein the host cell:

(a) comprises an alpha1,6-fucosyltransferase (Fut8) or alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltranferase (MGAT1) knockout; or

(b) overexpresses β1,4-N-acetylglucosaminyltransferase III (GnT-III).

67. The isolated host cell of claim 66 , wherein the host cell overexpresses GnT-III and further overexpresses Golgi μ-mannosidase II (ManII).

68. A method of producing an antibody, comprising culturing the host cell of claim 63 under conditions suitable for production of the antibody.

69. The method of claim 68 , wherein, prior to production of the antibody, the host cell is treated with kifunensine.

70. An antibody or antigen-binding fragment thereof that binds to human Dectin-1 produced by the method of claim 68 .

71. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier.

72. A method of treating a disease or disorder, wherein the disease or disorder is cancer, a bacterial infection, a fungal infection, a viral infection, a mast cell disease or disorder, systemic mastocytosis, amyloidosis, or an aging-related disease or disorder, comprising administering an effective amount of the composition of claim 71 to an individual in need thereof.

73. The method of claim 72 , wherein a first target of interest is human Dectin-1, and wherein a second target of interest is a disease-causing agent.

74. The method of claim 73 , wherein the disease-causing agent is a bacterial cell, fungal cell, virus, senescent cell, tumor cell, protein aggregate, LDL particle, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

75. The method of claim 74 , wherein the target of interest is an antigen expressed on the surface of the virus, bacterial cell, fungal cell, senescent cell, tumor cell, mast cell, eosinophil, ILC2 cell, or inflammatory immune cell.

76. The method of claim 72 , wherein a target of interest is an antigen expressed on the surface of a cancer cell.

77. The method of claim 72 , wherein the individual is a human.

78. A multispecific binding molecule, comprising:

(a) a first antibody or antigen-binding fragment thereof comprising a first antigen-binding domain, wherein the first antigen-binding domain binds to human Dectin-1, wherein the first antigen-binding domain comprises a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein the VH domain comprises a CDR-H1, CDR-H2, and CDR-H3 from the VH domain sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWIN PNSGDTNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGY WGQGTLVTVSS (SEQ ID NO:7), and wherein the VL domain comprises a CDR-L1, CDR-L2, and CDR-L3 from the VL domain sequence DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIFGASSLQ SGVPSRFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSFPFTFGPGTKVDIE (SEQ ID NO:8); and

(b) a second antibody or antigen-binding fragment thereof comprising a second antigen-binding domain, wherein the second antigen binding domain binds to a target of interest.

79. The multispecific binding molecule of claim 78 , wherein the VH domain comprises a CDR-H1 comprising the sequence DYYI (SEQ ID NO:88), a CDR-H2 comprising the sequence WINPNSGDTNYAQKFQG (SEQ ID NO:89), and a CDR-H3 comprising the sequence NSGSYSFGY (SEQ ID NO:90), and wherein the VL domain comprises a CDR-L1 comprising the sequence RASQGISSWLA (SEQ ID NO:91), a CDR-L2 comprising the sequence GASSLQS (SEQ ID NO:92), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6).

80. A polynucleotide encoding the antibody of claim 5 .

81. A vector comprising the polynucleotide of claim 80 .

82. An isolated host cell comprising the polynucleotide of claim 80 .

83. A method of producing an antibody, comprising culturing the host cell of claim 82 under conditions suitable for production of the antibody.

84. A pharmaceutical composition comprising the antibody of claim 5 and a pharmaceutically acceptable carrier.

85. A method of treating a disease or disorder, wherein the disease or disorder is cancer, a bacterial infection, a fungal infection, a viral infection, a mast cell disease or disorder, systemic mastocytosis, amyloidosis, or an aging-related disease or disorder, comprising administering an effective amount of the composition of claim 84 to an individual in need thereof.

86. A polynucleotide encoding the multispecific binding molecule of claim 33 .

87. A vector comprising the polynucleotide of claim 86 .

88. An isolated host cell comprising the polynucleotide of claim 86 .

89. A method of producing a multispecific binding molecule, comprising culturing the host cell of claim 88 under conditions suitable for production of the multispecific binding molecule.

90. A pharmaceutical composition comprising the multispecific binding molecule of claim 33 and a pharmaceutically acceptable carrier.

91. A method of treating a disease or disorder, wherein the disease or disorder is cancer, a bacterial infection, a fungal infection, a viral infection, a mast cell disease or disorder, systemic mastocytosis, amyloidosis, or an aging-related disease or disorder, comprising administering an effective amount of the composition of claim 90 to an individual in need thereof.

92. A polynucleotide encoding the multispecific binding molecule of claim 40 .

93. A vector comprising the polynucleotide of claim 92 .

94. An isolated host cell comprising the polynucleotide of claim 92 .

95. A method of producing a multispecific binding molecule, comprising culturing the host cell of claim 94 under conditions suitable for production of the multispecific binding molecule.

96. A pharmaceutical composition comprising the multispecific binding molecule of claim 40 and a pharmaceutically acceptable carrier.

97. A method of treating a disease or disorder, wherein the disease or disorder is cancer, a bacterial infection, a fungal infection, a viral infection, a mast cell disease or disorder, systemic mastocytosis, amyloidosis, or an aging-related disease or disorder, comprising administering an effective amount of the composition of claim 96 to an individual in need thereof.

Assignments (2)
CHANGE OF NAME Recorded Jul 7, 2025
From: DREN BIO, INC.
To: DREN BIO MANAGEMENT, INC.
Reel/Frame 071861/0269 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Oct 15, 2021
From: FOTAKIS, PANAGIOTIS; AH YOUNG-CHAPON, ANDREW P.; TOMASEVIC, NENAD; SHI, RUO SHI; DENG, XIAODI
To: DREN BIO, INC.
Reel/Frame 057808/0546 →
Continuity (3)
Provisional Application 63174439 · Apr 13, 2021
Provisional Application 63088895 · Oct 7, 2020
Related Publication 20220127366A1 · Apr 28, 2022