Recombinant fused polypeptide and use thereof
View Patent ↗The present invention discloses a recombinant fused polypeptide, a preparation method therefor, and use thereof. The recombinant fused polypeptide is represented by the following general formula: X-linker1-Y; Y-linker1-X; X-linker2-Y; Y-linker2-X, where X is PRCWRGEGGGGIVRRADRAAVPGGGGRGD; and Y is Acetyl-SDKPGGGGTSLDASIIWAMMQNGGGGLSKL. The recombinant fused polypeptide according to the present invention can treat various fibrosis diseases and symptoms, and therapeutic use includes anti-pulmonary fibrosis, anti-hepatic fibrosis, anti-skin fibrosis, anti-renal fibrosis, anti-myocardial fibrosis, and resistance to lung tissue lesions.
1. A recombinant fused polypeptide, wherein the recombinant fused polypeptide comprises a polypeptide X and a polypeptide Y, which are expressed by the following general formula: X-linker1-Y; Y-linker1-X; X-linker2-Y; Y-linker2-X, wherein X is PRCWRGEGGGGIVRRADRAAVPGGGGRGD (SEQ ID NO: 5); and Y is SDKPGGGGTSLDASIIWAMMQNGGGGLSKL (SEQ ID NO: 6).
2. The recombinant fused polypeptide according to claim 1 , wherein linker1 is GGGGSGGGGSGGGGS (SEQ ID NO: 7); and linker2 is AEAAAKEAAAKEAAAKEAAAKK (SEQ ID NO: 8).
3. The recombinant fused polypeptide according to claim 1 , wherein an amino acid sequence of the fused polypeptide is any one of the following:
(SEQ ID NO: 1)
PRCWRGEGGGGIVRRADRAAVPGGGGRGDGGGGSGGGGSG
GGGSSDKPGGGGTSLDASIIWAMMQNGGGGLSKL;
(SEQ ID NO: 2)
SDKPGGGGTSLDASIIWAMMQNGGGGLSKLGGGGSGGGGS
GGGGSPRCWRGEGGGGIVRRADRAAVPGGGGRGD;
(SEQ ID NO: 3)
PRCWRGEGGGGIVRRADRAAVPGGGGRGDAEAAAKEAAAK
EAAAKEAAAKKSDKPGGGGTSLDASIIWAMMQNGGGGLSK
L;
and
(SEQ ID NO: 4)
SDKPGGGGTSLDASIIWAMMQNGGGGLSKLAEAAAKEAAA
KEAAAKEAAAKKPRCWRGEGGGGIVRRADRAAVPGGGGRG
D.
4. A recombinant fused polypeptide, wherein the polypeptide comprises a polypeptide sequence with 80% homology with the amino acid sequence of the fused polypeptide according to claim 1 .
5. A method for the preparation of anti-fibrosis drugs, comprising providing a pharmaceutical composition comprising the recombinant fused polypeptide of claim 1 .
6. The method of claim 5 , wherein the anti-fibrosis drug is used to treat a tissue fibrosis selected from the group consisting of pulmonary fibrosis, hepatic fibrosis, renal fibrosis, myocardial fibrosis, and skin fibrosis, wherein the treating comprises administering the pharmaceutical composition of claim 5 to a subject in need thereof.
7. The method of claim 6 , wherein the tissue fibrosis comprises lung tissue lesions comprising bacterial pneumonia, viral pneumonia, mycoplasma pneumonia, fungal pneumonia, chlamydia pneumonia or protozoal pneumonia.
8. The method of claim 5 , wherein the pharmaceutical composition is administered in an injection, a capsule, a tablet, a nasal spray or an aerosol.
9. The method of claim 7 , wherein the pharmaceutical composition is administered to treat lung lesions and is in the form of an injection, a capsule, a tablet, a nasal spray or an aerosol.