CELL SELECTION AND/OR STIMULATION DEVICES AND METHODS OF USE
Provided herein are devices and methods for selecting and stimulating a plurality of cells in a sample of cells using column chromatography. In some aspects. provided is a device comprising a temperature control member to provide heat to a chromatography stationary phase and a connector configured to provide air to the stationary phase during column chromatography. In some aspects. the devices and methods provided herein reduce the time needed to generate a population of selected and stimulated cells useful for genetic engineering. and ultimately, cell therapy. compared to existing devices and methods.
1 . A chromatography column, comprising a housing assembly for column chromatography, the housing assembly comprising:
an inlet housing member and an outlet housing member, wherein at least the inlet housing member and the outlet housing member form an internal cavity configured to house a stationary phase for column chromatography;
a temperature control member configured to provide heat to the stationary phase in the internal cavity; and
a connector configured to operably connect the internal cavity to a gas source, thereby permitting or effecting intake of gas into the internal cavity.
2 . The chromatography column of claim 1 , the housing assembly further comprising a side wall member, wherein the inlet housing member, the outlet housing member, and the side wall member form the internal cavity.
3 . The chromatography column of claim 1 , wherein the connector comprises one or more filters.
4 . The chromatography column of claim 3 , wherein the one or more filters is a gas filters.
5 . The chromatography column of claim 1 , wherein:
the inlet housing member comprises one or more inlets operably connected to the internal cavity to permit intake of an input composition into the internal cavity; and/or
the outlet housing member comprises one or more outlets operably connected to the internal cavity to permit or effect discharge of an output composition from the internal cavity.
6 - 9 . (canceled)
10 . The chromatography column of claim 1 , further comprising:
a first porous member configured to separate the stationary phase and an inlet of the internal cavity, wherein the first porous member is optionally between the inlet housing member and the side wall member; and/or
a second porous member configured to separate the stationary phase and an outlet of the internal cavity, wherein the second porous member is between the outlet housing member and the side wall member.
11 - 12 . (canceled)
13 . The chromatography column of claim 1 , wherein the temperature control member is configured to heat the stationary phase to a target temperature between about 30° C. and about 39° C.
14 - 18 . (canceled)
19 . The chromatography column of claim 1 , wherein the temperature control member comprises a plurality of heating elements.
20 - 25 . (canceled)
26 . The chromatography column of claim 19 , wherein at least one of the plurality of heating elements is an electromagnetic induction heating element comprising an induction heating coil surrounding a magnetizable core configured to provide heat to the stationary phase in the internal cavity.
27 . The chromatography column of claim 19 , wherein at least one of the plurality of heating elements is a non-electric heating element comprising a heating channel comprising an inlet and an outlet for a heated fluid.
28 - 31 . (canceled)
32 . The chromatography column of claim 19 , wherein at least one of the plurality of heating elements is disposed inside the internal cavity, outside the internal cavity, or partially inside and partially outside the internal cavity; and/or surrounds at least a portion of the inlet housing member, at least a portion of the outlet housing member, and/or at least a portion of the side wall member.
33 - 36 . (canceled)
37 . The chromatography column of claim 19 , wherein at least a portion of at least one of the plurality of heating elements is in contact with at least a portion of the inlet housing member, at least a portion of the outlet housing member, and/or at least a portion of the side wall member.
38 . The chromatography column of claim 37 , wherein the housing assembly further comprises an insulation layer between at least one of the plurality of heating elements and at least a portion of the inlet housing member, at least a portion of the outlet housing member, and/or at least a portion of the side wall member.
39 - 44 . (canceled)
45 . The chromatography column of claim 19 , wherein the housing assembly further comprises a jacket member comprising at least one of the plurality of heating elements, wherein the jacket member is configured to surround at least a portion of the inlet housing member, at least a portion of the outlet housing member, and/or at least a portion of the side wall member.
46 . The chromatography column of claim 45 , wherein the jacket member is releasably connected together to surround the at least a portion of the inlet housing member, the at least a portion of the outlet housing member, and/or the at least a portion of the side wall member.
47 . The chromatography column of claim 46 , wherein the jacket member is configured to surround at least a portion of the side wall member, or is configured to entirely surround the side wall member.
48 - 55 . (canceled)
56 . A jacket member for column chromatography, comprising:
one or more jacket components configured to surround at least a portion of a chromatography column; and
one or more heating elements, wherein the one or more heating elements are configured in the one or more jacket components to provide heat to the chromatography column.
57 - 88 . (canceled)
89 . A chromatography system, comprising the chromatography column of claim 1 and at least one additional chromatography column.
90 - 91 . (canceled)
92 . The chromatography column of claim 1 , wherein the internal cavity of the housing assembly comprises a stationary phase for column chromatography.
93 . A chromatography column, comprising the jacket member of claim 56 , wherein the internal cavity of the chromatography column comprises a stationary phase for column chromatography.
94 . A chromatography column set, comprising at least one jacket member of claim 56 and a plurality of chromatography columns, wherein the internal cavity of each of the chromatography column comprises a stationary phase for column chromatography.
95 - 97 . (canceled)
98 . The chromatography column of claim 93 , wherein the stationary phase comprises an affinity chromatography matrix.
99 . The chromatography column of claim 1 , wherein the internal cavity comprises a stationary phase, and the stationary phase comprises or is a non-magnetic material, a non-ferromagnetic material, or non-paramagnetic material.
100 . The chromatography column of claim 1 , wherein the internal cavity comprises a stationary phase, and the stationary phase comprises a selection agent immobilized thereon.
101 . The chromatography column of claim 100 , wherein the selection agent is capable of specific binding to a selection marker on the surface of one or more cells wherein the one or cell are immune cells or T cells.
102 - 103 . (canceled)
104 . The chromatography column of claim 100 , wherein the selection agent is or comprises an agent selected from the group consisting of antibody fragments, monovalent antibody fragments, proteinaceous binding molecules with immunoglobulin-like functions, molecules containing Ig domains, cytokines, chemokines, aptamers, MHC molecules, MHC-peptide complexes; receptor ligands; and binding fragments thereof.
105 . The chromatography column of claim 101 , wherein:
the selection marker is a T cell coreceptor;
the selection marker is or comprises a member of a T cell antigen receptor complex;
the selection marker is or comprises a CD3 complex;
the selection marker is or comprises a CD3 chain;
the selection marker is or comprises a CD3γ, CD3δ, CD3ε, or CD3ζ chain;
the selection marker is or comprises CD8;
the selection marker is or comprises CD4;
the selection marker is or comprises CD45RA;
the selection marker is or comprises CD27;
the selection marker is or comprises CD28; and/or
the selection marker is or comprises CCR7.
106 . (canceled)
107 . The chromatography column of claim 101 wherein the selection agent comprises or is an anti-CD3 Fab, an anti-CD8 Fab, an anti-CD4 Fab, or an anti-CD27 Fab.
108 . The chromatography column of claim 101 , wherein the selection agent is bound indirectly to the stationary phase through a selection reagent to which the selection agent reversibly binds.
109 . The chromatography column of claim 108 , wherein the selection reagent comprises or is a mutein of streptavidin that reversibly binds a streptavidin-binding peptide.
110 - 117 . (canceled)
118 . The chromatography column of claim 109 , wherein the streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 3 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 15), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 3 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 17), SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK (SEQ ID NO: 16), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18), and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 Gly-Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19).
119 . The chromatography column of claim 109 , wherein the streptavidin mutein comprises the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 of SEQ ID NO: 1, or the streptavidin mutein comprises the amino acid sequence Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 of SEQ ID NO: 1.
120 . The chromatography column of claim 109 , wherein the N-terminal amino acid residue of the streptavidin mutein is in the region of amino acids 10 to 16 of SEQ ID NO: 1, and the C-terminal amino acid residue of the streptavidin mutein is in the region of amino acids 133 to 142 of SEQ ID NO: 1.
121 . The chromatography column of claim 109 , wherein the streptavidin mutein comprises the amino acid sequence set forth in any of SEQ ID NOs: 3-6, 27, 28, 104, and 105.
122 - 125 . (canceled)
126 . A method of on-column stimulation of T cells, the method comprising:
incubating, in the chromatography column of claim 1 a sample comprising a plurality of T cells with one or more stimulatory agent to deliver a stimulatory signal in one or more T cells of the plurality of T cells, wherein the plurality of T cells are immobilized on the stationary phase; and
after the initiation of the incubation, collecting the one or more T cells from the stationary phase, thereby generating an output composition comprising stimulated T cells.
127 . The method of claim 126 , wherein the stationary phase comprises a selection agent that specifically binds to a selection marker on the surface of the one or more T cells, wherein specific binding of the selection agent to the selection marker expressed by the one or more T cells effects the immobilization of the one or more T cells on the stationary phase.
128 - 163 . (canceled)
164 . The chromatography column of claim 101 , wherein the one or more cells are CD3+, CD4+, or CD8+ T cells.
165 . The chromatography column of claim 1 comprising a stationary phase, wherein the stationary phase comprises an affinity chromatography matrix.