IP Library › Granted Patent US 12,195,527
Granted Patent B2
US 12,195,527 · App. 18/316,999 · Granted Jan 14, 2025

Anti-PD-1/VEGFA bifunctional antibody, pharmaceutical composition thereof

Inventors: Baiyong Li (Zhongshan, CN); Yu Xia (Zhongshan, CN); Zhongmin Maxwell Wang (Zhongshan, CN); Peng Zhang (Zhongshan, CN)
Assignee: AKESO BIOPHARMA, INC.
C07K16/22A61K47/6849A61P35/00C07K16/2818A61K2039/505
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,195,527
App. No.
18/316,999
Granted
Jan 14, 2025
Kind
B2
Abstract

The present application relates to the fields of tumor treatment and molecular immunology, and specifically, to an anti-VEGFA/PD-1 bifunctional antibody, a pharmaceutical composition thereof and use thereof. Specifically, the anti-VEGFA/PD-1 bifunctional antibody comprises an antibody or antigen binding fragment thereof targeting VEGFA and an antibody or antigen binding fragment thereof targeting PD-1. The bifunctional antibody can specifically bind to VEGFA and PD-1, specifically relieve immunosuppression of VEGFA and PD-1 in an organism, and inhibit tumor-induced angiogenesis.

Claims (89)

1. A bispecific antibody, wherein the bispecific antibody comprises:

(a) an anti-VEGFA IgG1 immunoglobulin that binds to human VEGFA, wherein the anti-VEGFA IgG1 immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:

(i) the heavy chain polypeptide comprises:

a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5, and

a human Ig gamma-1 chain constant region; and

(ii) the light chain polypeptide comprises:

a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7, and

a human Ig kappa constant region; and

(b) two anti-PD-1 single chain antibodies that bind to human PD-1, wherein each of the two anti-PD-1 single chain antibodies comprises:

(i) a VH region, wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:9, and

(ii) a VL region, wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:11,

wherein the VH region and the VL region of one of the two anti-PD-1 single chain antibodies are linked by a first linker having the amino acid sequence set forth in SEQ ID NO:13, and the VH region and the VL region of the other of the two anti-PD-1 single chain antibodies are linked by a second linker having the amino acid sequence set forth in SEQ ID NO:13; and

wherein one terminus of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a third linker having the amino acid sequence set forth in SEQ ID NO:13 and wherein one terminus of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a fourth linker having the amino acid sequence set forth in SEQ ID NO:13.

2. The bispecific antibody according to claim 1 , wherein each of the two anti-PD-1 single chain antibodies comprises the amino acid sequence of:

(SEQ ID NO: 27)

EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT

ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY

GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS

ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF

SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.

3. The bispecific antibody according to claim 1 , wherein: the VH region of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13; and the VH region of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13.

4. The bispecific antibody according to claim 1 , wherein the VL region of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the VL region of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13.

5. The bispecific antibody according to claim 1 , wherein:

for one of the two anti-PD-1 single chain antibodies, the N-terminus of the VH region is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the C-terminus of the VH region of the anti-PD-1 single chain antibody is linked to the N-terminus of the VL region of the anti-PD-1 single chain antibody via a linker having the amino acid sequence set forth in SEQ ID NO:13; and

for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the VH region is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the C-terminus of the VH region of the anti-PD-1 single chain antibody is linked to the N-terminus of the VL region of the anti-PD-1 single chain antibody via a linker having the amino acid sequence set forth in SEQ ID NO:13.

6. A pharmaceutical composition comprising the bispecific antibody according to claim 1 and a pharmaceutically acceptable excipient.

7. A pharmaceutical composition comprising the bispecific antibody according to claim 5 and a pharmaceutically acceptable excipient.

8. A bispecific antibody in IgG-scFv form, wherein:

(a) the IgG portion of the bispecific antibody is an anti-human VEGFA immunoglobulin, wherein the anti-human VEGFA immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:

(a)(i) the heavy chain polypeptide comprises a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5; and

(a)(ii) the light chain polypeptide comprises a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7; and

(b) the scFv portion of the bispecific antibody is two anti-human PD-1 single chain antibodies, wherein each of the two anti-human PD-1 single-chain antibodies comprises:

(b)(i) the amino acid sequence set forth in SEQ ID NO:9, linked via

(b)(ii) a linker to

(b)(iii) the amino acid sequence set forth in SEQ ID NO:11,

wherein one terminus of each of the two anti-human PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin via a linker, and

wherein the linker of (b)(ii) and the linker linking a terminus of an anti-human PD-1 single chain antibody to the C-terminus of one of the two heavy chain polypeptides are each independently a [GGGGS (SEQ ID NO: 14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6.

9. The bispecific antibody according to claim 8 , wherein the linker of (b)(ii) and the linker linking a terminus of an anti-human PD-1 single chain antibody to the C-terminus of one of the two heavy chain polypeptides are the same.

10. The bispecific antibody according to claim 8 , wherein each of the two anti-human PD-1 single chain antibodies comprises the amino acid sequence of:

(SEQ ID NO: 27)

EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT

ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY

GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS

ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF

SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.

11. The bispecific antibody according to claim 8 , wherein the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.

12. The bispecific antibody according to claim 8 , wherein the amino acid sequence set forth in SEQ ID NO:11 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.

13. The bispecific antibody according to claim 8 , wherein:

for one of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11;

for the other of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11; and

for each of the two anti-human PD-1 single chain antibodies, the same linker amino acid sequence links the amino acid sequence set forth in SEQ ID NO:9 to the amino acid sequence set forth in SEQ ID NO:11; and/or for each of the two anti-human PD-1 single chain antibodies, the same linker amino acid sequence links the amino acid sequence set forth in SEQ ID NO:9 to the C-terminus of a heavy chain polypeptide of the anti-human VEGFA immunoglobulin.

14. The bispecific antibody according to claim 10 , wherein:

for one of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin; and

for the other of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.

15. A pharmaceutical composition comprising the bispecific antibody according to claim 8 and a pharmaceutically acceptable excipient.

16. A pharmaceutical composition comprising the bispecific antibody according to claim 14 and a pharmaceutically acceptable excipient.

17. A bispecific antibody, comprising:

(a) an anti-VEGFA immunoglobulin that binds to human VEGFA, wherein the anti-VEGFA immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:

(i) the heavy chain polypeptide comprises:

a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5, and

an immunoglobulin CH1-CH2-CH3; and

(ii) the light chain polypeptide comprises:

a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7, and

an immunoglobulin CL; and

(b) two anti-PD-1 single chain antibodies that bind to human PD-1, wherein each of the two anti-PD-1 single chain antibodies comprises:

(b)(i) the amino acid sequence set forth in SEQ ID NO:9 and

(b)(ii) the amino acid sequence set forth in SEQ ID NO:11,

wherein in one of the two anti-PD-1 single chain antibodies, a first linker links the amino acid sequences set forth in SEQ ID NOs:9 and 11 to one another, and in the other of the two anti-PD-1 single chain antibodies, a second linker links the amino acid sequences set forth in SEQ ID NOs:9 and 11 to one another,

wherein one terminus of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin via a third linker, and wherein one terminus of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin via a fourth linker, and

wherein the first linker and the second linker have the same amino acid sequence as one another, and wherein the third linker and the fourth linker have the same amino acid sequence as one another, and

wherein the first linker and the second linker are a [GGGGS (SEQ ID NO:14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6, and

the third linker and the fourth linker are a [GGGGS (SEQ ID NO:14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6.

18. The bispecific antibody according to claim 17 , wherein each of the two anti-PD-1 single chain antibodies comprises the amino acid sequence of:

(SEQ ID NO: 27)

EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT

ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY

GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS

ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF

SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.

19. The bispecific antibody according to claim 17 , wherein the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin.

20. The bispecific antibody according to claim 17 , wherein the amino acid sequence set forth in SEQ ID NO:11 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.

21. The bispecific antibody according to claim 17 , wherein:

for one of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11; and

for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11.

22. The bispecific antibody according to claim 18 , wherein:

for one of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin; and

for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin.

23. A pharmaceutical composition comprising the bispecific antibody according to claim 17 and a pharmaceutically acceptable excipient.

24. A pharmaceutical composition comprising the bispecific antibody according to claim 22 and a pharmaceutically acceptable excipient.

Assignments (2)
CHANGE OF NAME Recorded Jan 20, 2026
From: AKESO BIOPHARMA, INC.
To: AKESO BIOPHARMA CO., LTD.
Reel/Frame 073524/0694 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Sep 5, 2025
From: LI, BAIYONG; XIA, YU; WANG, ZHONGMIN MAXWELL; ZHANG, PENG
To: AKESO BIOPHARMA, INC.
Reel/Frame 072178/0594 →
Priority Claims (1)
CN 201811002548.4 · Aug 30, 2018 · national
Continuity (2)
Continuation 17272121
Related Publication 20230340097A1 · Oct 26, 2023
References Cited (116)
US 6884879B1 · Baca et al. · 2005 [cited by applicant]
US 7060269B1 · Baca et al. · 2006 [cited by applicant]
US 7297334B2 · Baca et al. · 2007 [cited by applicant]
US 9079953B2 · Harding et al. · 2015 [cited by applicant]
US 9815893B2 · Akamatsu · 2017 [cited by applicant]
US 11459405B2 · Sasisekharan et al. · 2022 [cited by examiner]
US 11578128B2 · Li et al. · 2023 [cited by applicant]
US 20120114649A1 · Langermann et al. · 2012 [cited by applicant]
US 20150376271A1 · Perlroth et al. · 2015 [cited by applicant]
US 20170275353A1 · Sheng et al. · 2017 [cited by applicant]
US 20170275375A1 · Rossi et al. · 2017 [cited by applicant]
US 20180305464A1 · Li et al. · 2018 [cited by applicant]
US 20190016817A1 · Taddei et al. · 2019 [cited by applicant]
US 20190185569A1 · Li et al. · 2019 [cited by applicant]
US 20190321466A1 · Li et al. · 2019 [cited by applicant]
US 20190367617A1 · Li et al. · 2019 [cited by applicant]
US 20200289493A1 · Bobilev et al. · 2020 [cited by applicant]
US 20200299389A1 · Her et al. · 2020 [cited by applicant]
US 20210040193A1 · Yang et al. · 2021 [cited by applicant]
US 20210340239A1 · Li et al. · 2021 [cited by applicant]
US 20210403563A1 · Wang et al. · 2021 [cited by applicant]
US 20210403575A1 · Wang et al. · 2021 [cited by applicant]
US 20220267444A1 · Wang et al. · 2022 [cited by applicant]
US 20220275089A1 · Xia et al. · 2022 [cited by applicant]
US 20230027029A1 · Zhang et al. · 2023 [cited by applicant]
US 20230235057A1 · Zhao et al. · 2023 [cited by applicant]
CN 105175544A · 2015 [cited by applicant]
CN 105175545A · 2015 [cited by applicant]
CN 106519034A · 2017 [cited by applicant]
CN 106967172A · 2017 [cited by applicant]
CN 106977602A · 2017 [cited by applicant]
CN 20160705624A · 2017 [cited by examiner]
CN 108752476A · 2018 [cited by applicant]
CN 109053895A · 2018 [cited by applicant]
CN 110498857A · 2019 [cited by applicant]
CN 110563849A · 2019 [cited by applicant]
CN 110831580A · 2020 [cited by applicant]
CN 110960543A · 2020 [cited by applicant]
CN 112300286A · 2021 [cited by applicant]
CN 112830972A · 2021 [cited by applicant]
EP 3450460A1 · 2019 [cited by applicant]
EP 3505535A1 · 2019 [cited by applicant]
EP 4067387A1 · 2022 [cited by applicant]
EP 4190816A1 · 2023 [cited by examiner]
WO WO2004099249A2 · 2004 [cited by applicant]
WO 2018036472A1 · 2008 [cited by applicant]
WO WO2009058812A1 · 2009 [cited by applicant]
WO 2011109789A2 · 2011 [cited by applicant]
WO WO2012023053A2 · 2012 [cited by applicant]
WO 2013142255A2 · 2013 [cited by applicant]
WO 2013181452A1 · 2013 [cited by applicant]
WO WO2015200905A2 · 2015 [cited by applicant]
WO 2017165681A1 · 2017 [cited by applicant]
WO 2017181111A2 · 2017 [cited by applicant]
WO 2017185662A1 · 2017 [cited by applicant]
WO 2018133837A1 · 2018 [cited by applicant]
WO WO2018223923A1 · 2018 [cited by applicant]
WO WO2019152642A1 · 2019 [cited by applicant]
WO WO2019154349A1 · 2019 [cited by applicant]
WO 2020177627A1 · 2020 [cited by applicant]
WO 2021003739A1 · 2021 [cited by applicant]
WO 2021007428A2 · 2021 [cited by applicant]
WO WO2021026685A1 · 2021 [cited by applicant]
WO 2021069670A1 · 2021 [cited by applicant]
WO WO2021104302A1 · 2021 [cited by applicant]
WO 2022005100A1 · 2022 [cited by applicant]
WO 2022143801A1 · 2022 [cited by applicant]
Uniprot, Acession P01857, IGHG1—Immunoglobulin heavy constant gamma 1— [cited by examiner]
Uniprot, Acession P01834, IGKC—Immunoglobulin kappa constant— [cited by examiner]
Zhong et al., Mechanism of Action of Ivonescimab (AK112/SMT112): a First-In-Class Tetravalent FC-Silent Bispecific Antibody With Dual Blockade of PD-1 and VEGF That Promotes Cooperative Biological, Abstract 1194, J. Imm… [cited by examiner]
International Search Report, mailed Nov. 27, 2019, for International Application No. PCT/CN2019/103618, 14 pages. [cited by applicant]
Office Action, Japanese Application No. 2021-510912, mailed Jan. 24, 2023 (12 pages). [cited by applicant]
Sun et al., “A novel bispecific c-MET/PD-1 antibody with therapeutic potential in solid cancer,” [cited by applicant]
Alfthan et al., “Properties of a single-chain antibody containing different linker peptides,” [cited by applicant]
Bird et al., “Single-Chain Antigen-Binding Proteins,” [cited by applicant]
Chothia et al., “Canonical Structures for the Hpervariable Regions of Immunoglobulins,” [cited by applicant]
Chothia et al., “Conformations of immunoglobulin hypervariable regions,” [cited by applicant]
Choi et al., “Recombinant chimeric OKT3 scFv IgM antibodies mediate immune suppression while reducing T cell activation in vitro,” [cited by applicant]
Clark, “Antibody humanization: a case of the ‘Emperor’s new clothes'?,” [cited by applicant]
Cui et al., “Research Progress of PD-1/PD-L1 Inhibitors Combined with Other Immune Checkpoint Inhibitors in the Treatment of Triple Negative Breast Cancer,” [cited by applicant]
Extended European Search Report, mailed Jul. 8, 2022, for European Patent Application No. 19853809.2-1111. (10 pages). [cited by applicant]
Fitzgerald et al., “Rational engineering of antibody therapeutics targeting multipleoncogene pathways,” [cited by applicant]
Ghonim et al., “Low Doses of PARP Inhibitors As A novel Therapeutic Approach to Enhance The Anti-Cancer Immunotherapy of PD-1 Immune Checkpoint Blockade,” [cited by applicant]
Holliger et al., ““Diabodies”: Small bivalent and bispecific antibody fragments,” PNAS N 90:6444-6448, Jul. 1993. (5 pages). [cited by applicant]
Hu et al., “Computational Design of IgG-like Tetra-specific Antibody Targeting EGFRNEGF/PD-1/CTLA-4 Against NSCLC,” [cited by applicant]
Hu et al., “Minibody: A Novel Engineered Anti-Carcinoembryonic Antigen Antibody Fragment (Single-Chain Fv-CH3) Which Exhibits Rapid, High-Level Targeting of Xenografts,” [cited by applicant]
International Search Report and Written Opinion of the International Searching Authority for International Application No. PCT/CN2020/131447 mailed on Jun. 3, 2021. [cited by applicant]
International Search Report, mailed Apr. 28, 2022, for International Patent Application No. PCT/CN2022/080107. (5 pages). [cited by applicant]
Jones et al., “Replacing the complementarity-determining regions in a human antibody Z with those from a mouse,” [cited by applicant]
Miller et al., “Stability engineering of scFvs for the development of bispecific and multivalent antibodies,” [cited by applicant]
Müller et al., “Bispecific Antibodies for Cancer Immunotherapy,” [cited by applicant]
Poljak, “Production and structure of diabodies,” [cited by applicant]
Presta, “Antibody engineering,” [cited by applicant]
Riechmann et al., “Reshaping human antibodies for therapy,” [cited by applicant]
Roovers et al., “In vitro characterisation of a monovalent and bivalent form of a fully human anti Ep-CAM phage antibody,” [cited by applicant]
Schlothauer et al., “Novel human lgG1 and lgG4 Fe-engineered antibodies with completely abolished immune effector functions,” [cited by applicant]
Tsuji, “The Forefront of Antibody Drugs,” CMC Publishing Co., Ltd., Jul. 20, 2007 (with English translation). (20 pages). [cited by applicant]
UniProt, “RecName: Full=Immunoglobulin kappa constant; AltName: Full=Ig kappa chain C region; AltName: Full=Ig kappa chain C region AG; AltName: Full=Ig kappa chain C region CUM; AltName: Full=Ig kappa chain C region EU… [cited by applicant]
UniProt, “RecName: Full=Immunoglobulin heavy constant gamma 4; AltName: Full=Ig gamma-4 chain C region,” sequence ID P01861.1, Jul. 21, 1986 (annotation updated Apr. 7, 2021) (6 pages). [cited by applicant]
UniProt, “RecName: Full=Immunoglobulin heavy constant gamma 1; AltName: Full=Ig gamma-1 chain C region; AltName: Full-Ig gamma-1 chain C region EU; AltName: Full=Ig gamma-1 chain C region KOL; AltName: Full=Ig gamma-1 c… [cited by applicant]
Ward et al., “Binding activities of a repertoire of single immunoglobulin variable domains secreted from [cited by applicant]
Hezareh et al., “Effector Function Activities of a Panel of Mutants of a Broadly Neutralizing Antibody against Human Immunodeficiency Virus Type 1,” [cited by applicant]
Pang et al., “Cadonilimab, a tetravalent PD-1/CTLA-4 bispecific antibody with trans-binding and enhanced target binding avidity,” [cited by applicant]
U.S. Appl. No. 18/024,478, filed Mar. 2, 2023. [cited by applicant]
U.S. Appl. No. 18/264,242, filed Aug. 3, 2023. [cited by applicant]
[cited by applicant]
Buchbinder et al., “CTLA-4 and PD-1 Pathways: Similarities, Differences, and Implications of Their Inhibition,” [cited by applicant]
Chan et al., “PARP Inhibitors in Cancer Diagnosis and Therapy,” [cited by applicant]
Coloma et al., “Design and production of novel tetravalent bispecific antibodies,” [cited by applicant]
Eichten et al., “Resistance to Anti-VEGF Therapy Mediated by Autocrine IL6/STAT3 Signaling and Overcome by IL6 Blockade,” [cited by applicant]
Extended European Search Report and Written Opinion, dated Jul. 12, 2024, for European Patent Application No. 22766354.9. (10 pages). [cited by applicant]
Fitzgerald et al., “Rational engineering of antibody therapeutics targeting multiple oncogene pathways,” [cited by applicant]
Lo et al., “Effector Attenuating Substitutions That Maintain Antibody Stability and Reduce Toxicity in Mice,” Journal of Biological Chemistry Papers in Press Manuscript, Jan. 11, 2017. (20 pages). [cited by applicant]
Moreno et al., “Anti-PD-1 Therapy in Melanoma,” [cited by applicant]
Vikas et al., “Therapeutic Potential of Combining PARP Inhibitor and Immunotherapy in Solid Tumors,” [cited by applicant]
Vinayak et al., “Open-label Clinical Trial of Niraparib Combined With Pembrolizumab for Treatment of Advanced or Metastatic Triple-Negative Breast Cancer,” [cited by applicant]