Anti-PD-1/VEGFA bifunctional antibody, pharmaceutical composition thereof
The present application relates to the fields of tumor treatment and molecular immunology, and specifically, to an anti-VEGFA/PD-1 bifunctional antibody, a pharmaceutical composition thereof and use thereof. Specifically, the anti-VEGFA/PD-1 bifunctional antibody comprises an antibody or antigen binding fragment thereof targeting VEGFA and an antibody or antigen binding fragment thereof targeting PD-1. The bifunctional antibody can specifically bind to VEGFA and PD-1, specifically relieve immunosuppression of VEGFA and PD-1 in an organism, and inhibit tumor-induced angiogenesis.
1. A bispecific antibody, wherein the bispecific antibody comprises:
(a) an anti-VEGFA IgG1 immunoglobulin that binds to human VEGFA, wherein the anti-VEGFA IgG1 immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:
(i) the heavy chain polypeptide comprises:
a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5, and
a human Ig gamma-1 chain constant region; and
(ii) the light chain polypeptide comprises:
a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7, and
a human Ig kappa constant region; and
(b) two anti-PD-1 single chain antibodies that bind to human PD-1, wherein each of the two anti-PD-1 single chain antibodies comprises:
(i) a VH region, wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:9, and
(ii) a VL region, wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:11,
wherein the VH region and the VL region of one of the two anti-PD-1 single chain antibodies are linked by a first linker having the amino acid sequence set forth in SEQ ID NO:13, and the VH region and the VL region of the other of the two anti-PD-1 single chain antibodies are linked by a second linker having the amino acid sequence set forth in SEQ ID NO:13; and
wherein one terminus of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a third linker having the amino acid sequence set forth in SEQ ID NO:13 and wherein one terminus of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a fourth linker having the amino acid sequence set forth in SEQ ID NO:13.
2. The bispecific antibody according to claim 1 , wherein each of the two anti-PD-1 single chain antibodies comprises the amino acid sequence of:
(SEQ ID NO: 27)
EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT
ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY
GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS
ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF
SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.
3. The bispecific antibody according to claim 1 , wherein: the VH region of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13; and the VH region of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13.
4. The bispecific antibody according to claim 1 , wherein the VL region of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the VL region of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13.
5. The bispecific antibody according to claim 1 , wherein:
for one of the two anti-PD-1 single chain antibodies, the N-terminus of the VH region is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the C-terminus of the VH region of the anti-PD-1 single chain antibody is linked to the N-terminus of the VL region of the anti-PD-1 single chain antibody via a linker having the amino acid sequence set forth in SEQ ID NO:13; and
for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the VH region is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA IgG1 immunoglobulin via a linker having the amino acid sequence set forth in SEQ ID NO:13 and the C-terminus of the VH region of the anti-PD-1 single chain antibody is linked to the N-terminus of the VL region of the anti-PD-1 single chain antibody via a linker having the amino acid sequence set forth in SEQ ID NO:13.
6. A pharmaceutical composition comprising the bispecific antibody according to claim 1 and a pharmaceutically acceptable excipient.
7. A pharmaceutical composition comprising the bispecific antibody according to claim 5 and a pharmaceutically acceptable excipient.
8. A bispecific antibody in IgG-scFv form, wherein:
(a) the IgG portion of the bispecific antibody is an anti-human VEGFA immunoglobulin, wherein the anti-human VEGFA immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:
(a)(i) the heavy chain polypeptide comprises a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5; and
(a)(ii) the light chain polypeptide comprises a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7; and
(b) the scFv portion of the bispecific antibody is two anti-human PD-1 single chain antibodies, wherein each of the two anti-human PD-1 single-chain antibodies comprises:
(b)(i) the amino acid sequence set forth in SEQ ID NO:9, linked via
(b)(ii) a linker to
(b)(iii) the amino acid sequence set forth in SEQ ID NO:11,
wherein one terminus of each of the two anti-human PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin via a linker, and
wherein the linker of (b)(ii) and the linker linking a terminus of an anti-human PD-1 single chain antibody to the C-terminus of one of the two heavy chain polypeptides are each independently a [GGGGS (SEQ ID NO: 14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6.
9. The bispecific antibody according to claim 8 , wherein the linker of (b)(ii) and the linker linking a terminus of an anti-human PD-1 single chain antibody to the C-terminus of one of the two heavy chain polypeptides are the same.
10. The bispecific antibody according to claim 8 , wherein each of the two anti-human PD-1 single chain antibodies comprises the amino acid sequence of:
(SEQ ID NO: 27)
EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT
ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY
GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS
ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF
SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.
11. The bispecific antibody according to claim 8 , wherein the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.
12. The bispecific antibody according to claim 8 , wherein the amino acid sequence set forth in SEQ ID NO:11 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.
13. The bispecific antibody according to claim 8 , wherein:
for one of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11;
for the other of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11; and
for each of the two anti-human PD-1 single chain antibodies, the same linker amino acid sequence links the amino acid sequence set forth in SEQ ID NO:9 to the amino acid sequence set forth in SEQ ID NO:11; and/or for each of the two anti-human PD-1 single chain antibodies, the same linker amino acid sequence links the amino acid sequence set forth in SEQ ID NO:9 to the C-terminus of a heavy chain polypeptide of the anti-human VEGFA immunoglobulin.
14. The bispecific antibody according to claim 10 , wherein:
for one of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin; and
for the other of the two anti-human PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.
15. A pharmaceutical composition comprising the bispecific antibody according to claim 8 and a pharmaceutically acceptable excipient.
16. A pharmaceutical composition comprising the bispecific antibody according to claim 14 and a pharmaceutically acceptable excipient.
17. A bispecific antibody, comprising:
(a) an anti-VEGFA immunoglobulin that binds to human VEGFA, wherein the anti-VEGFA immunoglobulin comprises two pairs of polypeptide chains, wherein each of the two pairs of polypeptide chains comprises a heavy chain polypeptide and a light chain polypeptide, wherein:
(i) the heavy chain polypeptide comprises:
a heavy chain variable region (VH region), wherein the amino acid sequence of the VH region is set forth in SEQ ID NO:5, and
an immunoglobulin CH1-CH2-CH3; and
(ii) the light chain polypeptide comprises:
a light chain variable region (VL region), wherein the amino acid sequence of the VL region is set forth in SEQ ID NO:7, and
an immunoglobulin CL; and
(b) two anti-PD-1 single chain antibodies that bind to human PD-1, wherein each of the two anti-PD-1 single chain antibodies comprises:
(b)(i) the amino acid sequence set forth in SEQ ID NO:9 and
(b)(ii) the amino acid sequence set forth in SEQ ID NO:11,
wherein in one of the two anti-PD-1 single chain antibodies, a first linker links the amino acid sequences set forth in SEQ ID NOs:9 and 11 to one another, and in the other of the two anti-PD-1 single chain antibodies, a second linker links the amino acid sequences set forth in SEQ ID NOs:9 and 11 to one another,
wherein one terminus of one of the two anti-PD-1 single chain antibodies is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin via a third linker, and wherein one terminus of the other of the two anti-PD-1 single chain antibodies is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin via a fourth linker, and
wherein the first linker and the second linker have the same amino acid sequence as one another, and wherein the third linker and the fourth linker have the same amino acid sequence as one another, and
wherein the first linker and the second linker are a [GGGGS (SEQ ID NO:14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6, and
the third linker and the fourth linker are a [GGGGS (SEQ ID NO:14)]m linker, wherein m is 1, 2, 3, 4, 5, or 6.
18. The bispecific antibody according to claim 17 , wherein each of the two anti-PD-1 single chain antibodies comprises the amino acid sequence of:
(SEQ ID NO: 27)
EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYDMSWVRQAPGKGLDWVAT
ISGGGRYTYYPDSVKGRFTISRDNSKNNLYLQMNSLRAEDTALYYCANRY
GEAWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSMS
ASVGDRVTFTCRASQDINTYLSWFQQKPGKSPKTLIYRANRLVSGVPSRF
SGSGSGQDYTLTISSLQPEDMATYYCLQYDEFPLTFGAGTKLELK.
19. The bispecific antibody according to claim 17 , wherein the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin.
20. The bispecific antibody according to claim 17 , wherein the amino acid sequence set forth in SEQ ID NO:11 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-human VEGFA immunoglobulin.
21. The bispecific antibody according to claim 17 , wherein:
for one of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11; and
for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin and the C-terminus of the amino acid sequence set forth in SEQ ID NO:9 is linked to the N-terminus of the amino acid sequence set forth in SEQ ID NO:11.
22. The bispecific antibody according to claim 18 , wherein:
for one of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of one of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin; and
for the other of the two anti-PD-1 single chain antibodies, the N-terminus of the amino acid sequence set forth in SEQ ID NO:27 is linked to the C-terminus of the other of the two heavy chain polypeptides of the anti-VEGFA immunoglobulin.
23. A pharmaceutical composition comprising the bispecific antibody according to claim 17 and a pharmaceutically acceptable excipient.
24. A pharmaceutical composition comprising the bispecific antibody according to claim 22 and a pharmaceutically acceptable excipient.