PEPTIDES FOR IMMUNOTHERAPY
The disclosure provides peptides, pharmaceutical compositions, and methods of producing thereof. Such peptides can be useful, for example, in treating various human diseases such as immunological diseases or cancers. In some embodiments, the peptides are useful as immunotherapeutics for modulating regulatory and effector molecules of the mammalian immune system.
1 . A peptide comprising an amino acid sequence having at least 85% sequence identity to any one of SEQ ID NOs: 1-65, preferably SEQ ID NO:46 (GQRQKHKPNECIVMVRGKRRIIKCKECMPKVSPRVKM) or SEQ ID NO:51 (LGKTDWIEKYFKVKKEKIDKMQRFLQG).
2 . The peptide of claim 1 , wherein the peptide comprises an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to any one of SEQ ID NOs: 1-65, preferably SEQ ID NO:46 (GQRQKHKPNECIVMVRGKRRIIKCKECMPKVSPRVKM) or SEQ ID NO:51 (LGKTDWIEKYFKVKKEKIDKMQRFLQG).
3 . The peptide of claim 1 or claim 2 , wherein the peptide comprises the amino acid sequence any one of SEQ ID NOs: 1-65, preferably of SEQ ID NO: 46 (GQRQKHKPNECIVMVRGKRRIIKCKECMPKVSPRVKM) or SEQ IDNO: 51 (LGKTDWIEKYFKVKKEKIDKMQRFLQG).
4 . The peptide of any one of claims 1-3 , wherein the peptide comprises at least one D-amino acid.
5 . The peptide of any one of claims 1-4 , wherein the peptide consists of D-amino acids.
6 . A nucleic acid construct comprising a polynucleotide, wherein the polynucleotide encodes a peptide of any one of claims 1-5 .
7 . A recombinant host cell comprising an exogenous polynucleotide, the polynucleotide encoding a peptide having at least 85%, at least 90%, at least 95%, or at least 99%, or 100% sequence identity to any one of SEQ ID NOs: 1-65.
8 . The recombinant host cell of claim 7 , wherein the exogenous polynucleotide further encodes a host cell specific signal sequence.
9 . The recombinant host cell of claim 7 or claim 8 , wherein the exogenous polynucleotide further encodes a heterologous promoter.
10 . The recombinant host cell of claim 9 , wherein the heterologous promoter is a constitutive promoter.
11 . The recombinant host cell of claim 9 , wherein the heterologous promoter is an inducible promoter.
12 . The recombinant host cell of any one of claims 7-11 , wherein the recombinant host cell is a prokaryotic cell, an eukaryotic cell, or a fungal cell.
13 . The recombinant host cell of claim 12 , wherein the recombinant host cell is selected from the group consisting of: an Escherichia coli cell, a Lactococcus lactis cell, a Streptomyces coelicolor cell, a Streptomyces lividans cell, a Streptomyces albus cell, a Streptomyces venezuelae cell, or a Bacillus subtilis cell.
14 . The recombinant host cell of claim 12 , wherein the recombinant host cell is a Saccharomyces cerevisiae cell, a Pichia pastoris cell, a Yarrowia lipolytica cell, an Aspergillus niger cell, or a Hansenula polymorpha cell.
15 . The recombinant host of claim 12 , wherein the eukaryotic cell is a Chinese Hamster Ovary cell.
16 . A pharmaceutical composition comprising:
a) a peptide having at least 85%, at least 90%, at least 95%, or at least 99%, or 100% sequence identity to any one of SEQ ID NOs: 1-65, the nucleic acid construct of claim 6 , or a plurality of recombinant host cells of any one of claims 7 - 15 ; and
b) a pharmaceutically acceptable carrier.
17 . The pharmaceutical composition of claim 16 , wherein the pharmaceutical composition is formulated for oral administration, rectal administration, intravenous administration, or intratumoral administration.
18 . The pharmaceutical composition of any one of claims 16-17 , wherein the pharmaceutical composition is formulated as a tablet, a capsule, a powder, or a liquid.
19 . The pharmaceutical composition of claim 18 , wherein the composition is formulated as a tablet.
20 . The pharmaceutical composition of claim 19 , wherein the tablet is coated.
21 . The pharmaceutical composition of claim 20 , wherein the coating comprises an enteric coating.
22 . A method of modulating the activity of one or more target proteins in a subject, the method comprising administering to the subject:
a) a peptide having at least 85% sequence identity to any one of SEQ ID NOs: 1-65, and/or
b) the peptide of any one of claims 1-5 , and/or
c) the nucleic acid construct of claim 6 , and/or
d) a plurality of recombinant host cells of any one of claims 7-15 , and/or e) the pharmaceutical composition of any one of claims 16 - 21 ;
wherein the one or more target proteins are selected from the group consisting of a CCR9 protein, a CXCR3 protein, and a CXCR4 protein.
23 . The method of claim 22 , wherein the CCR9 protein and/or the CXCR3 protein has an activity that is increased relative to a subject that did not receive treatment or relative to a reference value.
24 . The method of claim 22 , wherein the CXCR4 protein has an activity that is decreased relative to a subject that did not receive treatment or relative to a reference value.
25 . The method of claim 23 or 24 , wherein the activity is measured with a beta-arrestin reporter cell assay.
26 . A method for treating a disease in a subject in need thereof, the method comprising administering to the subject:
a) a peptide having at least 85% sequence identity to any one of SEQ ID NOs: 1-65, and/or
b) the peptide of any one of claims 1-5 , and/or
c) the nucleic acid construct of claim 6 , and/or
d) a plurality of recombinant host cells of any one of claims 7-15 , and/or
e) the pharmaceutical composition of any one of claims 16-21 .
27 . The method of claim 26 , wherein the disease is a neoplasm.
28 . The method of claim 26 or claim 27 , wherein the disease is cancer.
29 . The method of claim 28 , wherein the cancer is at least one selected from the group consisting of: melanoma, renal cell carcinoma, non-small cell lung carcinoma, basal cell carcinoma, biliary tract cancer, bladder cancer, bone cancer, brain and central nervous system cancer, breast cancer, cervical cancer, choriocarcinoma, colon and rectum cancer, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, cancer of the head and neck, gastric cancer, intra-epithelial neoplasm, kidney cancer, larynx cancer, leukemia, liver cancer, small-cell lung cancer, Hodgkin's lymphoma, non-Hodgkins lymphoma, myeloma, neuroblastoma, oral cavity cancer, ovarian cancer, pancreatic cancer, prostate cancer, retinoblastoma, rhabdomyosarcoma, rectal cancer, cancer of the respiratory system, sarcoma, skin cancer, stomach cancer, testicular cancer, thyroid cancer, uterine cancer, and cancer of the urinary system.
30 . A method for increasing the response to an immunotherapy in a subject in need thereof comprising administering to the subject a composition, wherein the composition comprises:
i) a peptide having at least 85% sequence identity to any one of SEQ ID NOs: 1-65, and/or
ii) the peptide of any one of claims 1-5 , and/or
iii) the nucleic acid construct of claim 6 , and/or
iv) a plurality of recombinant host cells of any one of claims 7-15 , and/or
v) the pharmaceutical composition of any one of claims 16-21 .
31 . The method of any one of claims 26-30 , wherein the peptide modulates the production of at least one cytokine in the subject relative to a reference value.
32 . The method of claim 31 , wherein the cytokine is selected from the group consisting of TNF-α, IL-17, IL-1β, IL-2, IFN-γ, IL-6, IL-12, IL-25, IL-33, IL-8, MCP-1, MIP-3α, CXCL1, IL-23, IL-4, IL-10, IL-13, IFN-α, and TGF-β.
33 . The method of any one of claims 26-32 , wherein the peptide induces the production of at least one pro-inflammatory cytokine in the subject relative to a reference value.
34 . The method of claim 33 , wherein the at least one pro-inflammatory cytokine is selected from the group consisting of TNF-α, IL-17, IL-1β, IL-2, IFN-γ, IL-6, IL-12, IL-25, IL-33, IL-8, MCP-1, MIP-3α, CXCL1, and IL-23.
35 . The method of any one of claims 26-34 , wherein the peptide suppresses the production of at least one anti-inflammatory cytokine in the subject relative to a reference value.
36 . The method of claim 35 , wherein the at least one anti-inflammatory cytokine is selected from the group consisting of IL-4, IL-10, IL-13, IFN-α, and TGF-β.
37 . The method of any one of claims 26-36 , wherein the peptide increases Th1 activation in the subject relative to a reference value.
38 . The method of any one of claims 26-37 , wherein the peptide increases dendritic cell maturation in the subject relative to a reference value.
39 . The method of any one of claims 26-38 , wherein the peptide increases CD70 expression in the subject relative to a reference value.
40 . The method of any one of claims 26-39 , wherein the peptide increases the clonal expansion of T eff in the subject relative to a reference value.
41 . The method of any one of claims 26-40 , wherein the peptide increases activity of a CCR9 protein or a CXCR3 protein relative to a reference value.
42 . The method of any one of claims 26-41 , wherein the peptide decreases activity of a CXCR4 protein relative to a reference value.
43 . The method of any one of claims 26-42 , wherein the peptide binds to a CCR9 protein, a CXCR3 protein, or a CXCR4 protein.
44 . The method of any one of claims 26-43 further comprising administering an additional treatment for cancer and/or other adjunct therapy to the subject.
45 . A method of treating cancer in a subject in need thereof, the method comprising:
a) administering to the subject:
i) a peptide having at least 85% sequence identity to any one of SEQ ID NOs: 1-65, and/or
ii) the peptide of any one of claims 1-5 , and/or
iii) the nucleic acid construct of claim 6 , and/or
iv) a plurality of recombinant host cells of any one of claims 7-15 , and/or
v) the pharmaceutical composition of any one of claims 16-21 ; and
b) administering to the subject an additional treatment for cancer and/or adjunct therapy to the subject.
46 . The method of claim 44 or claim 45 , wherein the additional treatment for cancer and/or adjunct therapy comprises a probiotic.
47 . The method of claim 44 or claim 45 , wherein the additional treatment for cancer and/or adjunct therapy comprises surgery, radiation therapy, or a combination thereof.
48 . The method of claim 44 or claim 45 , wherein the additional treatment for cancer and/or adjunct therapy comprises a therapeutic agent.
49 . The method of claim 48 , wherein the therapeutic agent comprises a chemotherapeutic agent, a targeted therapy, an additional immunotherapy, or a combination thereof.
50 . The method of claim 49 , wherein the chemotherapeutic agent comprises carboplatin, cisplatin, gemcitabine, methotrexate, paclitaxel, pemetrexed, lomustine, temozolomide, dacarbazine, or a combination thereof.
51 . The method of claim 49 , wherein the targeted therapy comprises afatinib dimaleate, bevacizumab, cetuximab, crizotinib, erlotinib, gefitinib, sorafenib, sunitinib, pazopanib, everolimus, dabrafenib, aldesleukin, interferon alfa-2b, ipilimumab, peginterferon alfa-2b, trametinib, vemurafenib, or a combination thereof.
52 . The method of claim 49 , wherein the additional immunotherapy comprises a cell therapy, a therapy with an immune checkpoint inhibitor, a therapy with a co-stimulatory immune checkpoint agent, or a combination thereof.
53 . The method of claim 52 , wherein the immune checkpoint inhibitor is selected from the group consisting of: ipilimumab, nivolumab, pembrolizumab, atezolizumab, avelumab, durvalumab, cemiplimab, and a combination thereof.
54 . The method of claim 52 , wherein the co-stimulatory immune checkpoint agent is selected from the group consisting of: IBI101, utomilumab, MEDI1873, and a combination thereof.
55 . The method of claim 52 , wherein the cell therapy is a CAR T cell therapy
56 . The method of any one of claims 26-55 , wherein the subject is a human.
57 . A method of producing a peptide, the method comprising culturing the recombinant host cell of any one of claims 7-15 , under conditions sufficient for expression of the encoded peptide.
58 . A method of producing a peptide, the method comprising chemically synthesizing the peptide of any one of SEQ ID NOs: 1-65.