IP Library Patent Application 19263140
Patent Application
App. No. 19/263,140

ANTI-DECTIN-1 ANTIBODIES AND METHODS OF USE THEREOF

Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US None
App. No.
19/263,140
Abstract

The present disclosure relates to antibodies that bind human Dectin-1, multispecific (e.g., bispecific) binding molecules, and methods of use and production related thereto.

Claims (59)

1 - 6 . (canceled)

7 . An antibody or antigen-binding fragment thereof that binds to human Dectin-1, wherein the antibody or fragment:

(a) binds to human Dectin-1 expressed on the surface of a cell with an EC50 of less than 2 nM;

(b) is capable of binding human or cynomolgus Dectin-1; and/or

(c) does not compete with a native ligand of human Dectin-1.

8 - 9 . (canceled)

10 . The antibody of claim 7 , wherein the antibody or fragment is a human or humanized antibody or fragment.

11 . The antibody of claim 7 , wherein the antibody or fragment competes for binding to human Dectin-1 with a reference antibody that comprises:

(a) a heavy chain variable (VH) domain comprising a CDR-H1 comprising the sequence GYTFTDYY (SEQ ID NO:1), a CDR-H2 comprising the sequence INPNSGDT (SEQ ID NO:2), and a CDR-H3 comprising the sequence ARNSGSYSFGY (SEQ ID NO:3), and a light chain variable (VL) domain comprising a CDR-L1 comprising the sequence QGISSW (SEQ ID NO:4), a CDR-L2 comprising the sequence GAS (SEQ ID NO:5), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6);

(b) a heavy chain variable (VH) domain comprising a CDR-H1 comprising the sequence DYYI (SEQ ID NO:88), a CDR-H2 comprising the sequence WINPNSGDTNYAQKFQG (SEQ ID NO: 89), and a CDR-H3 comprising the sequence NSGSYSFGY (SEQ ID NO:90), and a light chain variable (VL) domain comprising a CDR-L1 comprising the sequence RASQGISSWLA (SEQ ID NO:91), a CDR-L2 comprising the sequence GASSLQS (SEQ ID NO:92), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6); or

(c) a heavy chain variable (VH) domain comprising the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7) and a light chain variable (VL) domain comprising the sequence

(SEQ ID NO: 8)

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLL

IFGASSLQSGVPSRFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSF

PFTFGPGTKVDIE.

12 . The antibody of claim 7 , wherein the antibody or fragment binds the same epitope of human Dectin-1 as a reference antibody that comprises:

(a) a heavy chain variable (VH) domain comprising a CDR-H1 comprising the sequence GYTFTDYY (SEQ ID NO:1), a CDR-H2 comprising the sequence INPNSGDT (SEQ ID NO:2), and a CDR-H3 comprising the sequence ARNSGSYSFGY (SEQ ID NO:3), and a light chain variable (VL) domain comprising a CDR-L1 comprising the sequence QGISSW (SEQ ID NO:4), a CDR-L2 comprising the sequence GAS (SEQ ID NO:5), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6);

(b) a heavy chain variable (VH) domain comprising a CDR-H1 comprising the sequence DYYI (SEQ ID NO:88), a CDR-H2 comprising the sequence WINPNSGDTNYAQKFQG (SEQ ID NO: 89), and a CDR-H3 comprising the sequence NSGSYSFGY (SEQ ID NO:90), and a light chain variable (VL) domain comprising a CDR-L1 comprising the sequence RASQGISSWLA (SEQ ID NO:91), a CDR-L2 comprising the sequence GASSLQS (SEQ ID NO:92), and a CDR-L3 comprising the sequence QQAYSFPFT (SEQ ID NO:6); or

(c) a heavy chain variable (VH) domain comprising the sequence QVQLVQSGAEVKKPGASVKVSCKSSGYTFTDYYIHWVRQAPGQGLEWMGWINPNSGD TNYAQKFQGRITMTRDTSISTAYLELSRLRSDDTAVFYCARNSGSYSFGYWGQGTLVTV SS (SEQ ID NO:7) and a light chain variable (VL) domain comprising the sequence

(SEQ ID NO: 8)

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLL

IFGASSLQSGVPSRFSGSGSGTDFTLTVSSLQPEDFATYYCQQAYSF

PFTFGPGTKVDIE.

13 . The antibody of claim 7 , wherein the antibody or fragment binds to human Dectin-1 expressed on the surface of a macrophage, monocyte, dendritic cell, and/or granulocyte.

14 . The antibody of claim 7 , wherein the antigen-binding antibody fragment is a Fab, Fab′, F(ab′)2, Fv, Fab′-SH, F(ab′)2, single chain antibody, nanobody, or scFv fragment.

15 . The antibody of claim 7 , wherein the antibody further comprises an Fc region.

16 - 115 . (canceled)

116 . A polynucleotide encoding the antibody of claim 7 .

117 . (canceled)

118 . An isolated host cell comprising the polynucleotide of claim 116 .

119 - 124 . (canceled)

125 . A method of producing an antibody, comprising culturing the host cell of claim 118 under conditions suitable for production of the antibody.

126 - 128 . (canceled)

129 . A pharmaceutical composition comprising the antibody of claim 7 and a pharmaceutically acceptable carrier.

130 . A method of generating a multispecific binding molecule, comprising:

(a) providing a first antibody or antigen-binding fragment thereof comprising a first antigen-binding domain, wherein the first antigen-binding domain binds to a first target of interest;

(b) providing a second antibody or antigen-binding fragment thereof comprising a second antigen-binding domain, wherein the second antigen binding domain binds to a second target of interest;

wherein:

(i) the first antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the second antibody or fragment is coupled to biotin or an avidin-binding derivative thereof; or

(ii) the second antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the first antibody or fragment is coupled to biotin or an avidin-binding derivative thereof; and

(c) contacting the first antibody or fragment with the second antibody or fragment under conditions suitable for binding between the first antibody or fragment and the second antibody or fragment via an interaction between the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof and the biotin or avidin-binding derivative thereof, thereby generating a multispecific binding molecule.

131 . A method of identifying a multispecific binding molecule that binds a first and a second target of interest, comprising:

(a) providing a first antibody or antigen-binding fragment thereof comprising a first antigen-binding domain, wherein the first antigen-binding domain binds to a first target of interest;

(b) providing a second antibody or antigen-binding fragment thereof comprising a second antigen-binding domain, wherein the second antigen binding domain binds to a second target of interest;

wherein:

(i) the first antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the second antibody or fragment is coupled to biotin or an avidin-binding derivative thereof; or

(ii) the second antibody or fragment is coupled to avidin, streptavidin, neutravidin, or a biotin-binding derivative thereof, and the first antibody or fragment is coupled to biotin or an avidin-binding derivative thereof;

(c) contacting the first antibody or fragment with the second antibody or fragment under conditions suitable for binding between the first antibody or fragment and the second antibody or fragment via an interaction between the avidin, streptavidin, neutravidin, or biotin-binding derivative thereof and the biotin or avidin-binding derivative thereof, thereby generating a multispecific binding molecule; and

(d) measuring binding between the multispecific binding molecule and at least one of the first and the second target of interest.

132 . The method of claim 130 , wherein the first target of interest is human Dectin-1.

133 - 136 . (canceled)

137 . The method of claim 132 , wherein the first antigen-binding domain binds to human Dectin-1 expressed on the surface of a macrophage, monocyte, dendritic cell, or granulocyte.

138 . The method of claim 130 , wherein one or both of the first and second antibodies or fragments are humanized antibodies or fragments.

139 . The method of claim 130 , wherein one or both of the first and second antibodies or fragments are Fab, Fab′, F(ab′)2, Fv, Fab′-SH, F(ab′)2, single chain antibodies, nanobodies, or scFv fragments.

140 . The method of claim 130 , wherein one or both of the first and second antibodies or fragments further comprise an Fc domain.

141 - 142 . (canceled)

143 . The method of claim 130 , wherein the first antibody or fragment is a Fab fragment coupled to monomeric streptavidin (mSA), and wherein the second antibody or fragment is a biotinylated antibody that comprises an antibody heavy chain and an antibody light chain.

144 . The method of claim 130 , wherein the first antibody or fragment is a full-length antibody coupled to monomeric streptavidin (mSA), and wherein the second antibody is a biotinylated antibody that comprises an antibody heavy chain and an antibody light chain.

145 - 175 . (canceled)

Assignments (2)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 28, 2025
From: FOTAKIS, PANAGIOTIS; AH YOUNG-CHAPON, ANDREW P.; TOMASEVIC, NENAD; SHI, RUO SHI; DENG, XIAODI
To: DREN BIO, INC.
Reel/Frame 071854/0055 →
CHANGE OF NAME Recorded Jul 28, 2025
From: DREN BIO, INC.
To: DREN BIO MANAGEMENT, INC.
Reel/Frame 072286/0574 →