Antibodies against CSF-1R
The invention provides a human antibody that binds human CSF-1R with high affinity. Antibodies of the present invention have significant advantages over the antibodies known in the art by being multifunctional: inhibiting signaling of CSF-1R, internalizing and inducing CSF-1R degradation and stimulating ADCC in cell including tumors, macrophages and monocytes. They are also shown to be effective in treating leukemia, breast, endometrial and prostate cancer alone or in combination with docetaxel, paclitaxel, Herceptin® or doxorubicin.
1. An antibody, or fragment thereof, that specifically binds human CSF-1R variant (SEQ ID NO. 15), comprising a CDRH1 comprising the sequence SYGMH (SEQ ID NO:1), a CDRH2 comprising the sequence VIWYDGSNKYYADSVKG (SEQ ID NO:2), a CDRH3 comprising the sequence GDYEVDYGMDV (SEQ ID NO:3), a CDRL1 comprising the sequence RASQGISNALA (SEQ ID NO:4), a CDRL2 comprising the sequence DASSLES (SEQ ID NO:5), and a CDRL3 comprising the sequence QQFNSYPWT (SEQ ID NO:6).
2. The antibody, or fragment thereof, of claim 1 , comprising a VL comprising the amino acid sequence:
(SEQ ID NO: 8)
AIQLTQSPSSLSASVGDRVTITCRASQGISNALAWYQQKPGKAPKLLI
YDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPW
TFGQGTKVEIK,
and a VH comprising the amino acid sequence:
(SEQ ID NO: 7)
QDQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGEGLEWV
AVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC
ARGDYEVDYGMDVWGQGTTVTVAS.
3. The antibody, or fragment thereof, of claim 2 , comprising a heavy chain comprising the amino acid sequence of SEQ ID NO:9 and a light chain comprising the amino acid sequence of SEQ ID NO:10.
4. The antibody, or fragment thereof, of claim 3 comprising two heavy chains, each comprising the amino acid sequence of SEQ ID NO:9 and two light chains, each comprising the amino acid sequence of SEQ ID NO:10.
5. A pharmaceutical composition comprising the antibody or fragment of claim 1 together with a pharmaceutically acceptable carrier, diluent or excipient.
6. A pharmaceutical composition of claim 5 further comprising an additional pharmaceutical agent.
7. A method of treating cancer in a mammal, comprising administering to said mammal in need thereof an effective amount of an antibody or fragment thereof of claim 1 , wherein the cancer is selected from the group consisting of leukemia, breast cancer, endometrial cancer, prostate cancer, ovarian cancer, colorectal cancer, hepatocellular cancer, renal cancer, multiple myeloma, and hodgkin's lymphoma.
8. The method of claim 7 , wherein the cancer is selected from the group consisting of leukemia, breast cancer, endometrial cancer, and prostate cancer.
9. The method of claim 8 , wherein the cancer is selected from the group consisting of leukemia, breast cancer, and prostate cancer.
10. The method of claim 7 , further comprising administering another anti-cancer treatment to said mammal wherein said anti-cancer treatment is selected from the group consisting of an anti-angiogenesis agent, a chemotherapeutic agent, and an anti-neoplastic agent.
11. The method of claim 10 , wherein said anti-neoplastic agent is selected from the group consisting of docetaxel, paclitaxel, Herceptin® and doxorubicin.
12. A method of treating cancer in a patient, comprising the steps: (1) measuring the level of CSF-1 in a sample taken from the patient wherein the sample is selected from the group consisting of blood, serum or plasma, and (2) administering to the patient the antibody or fragment thereof according to claim 1 if the CSF-1 levels are higher than CSF-1 levels found in blood, serum or plasma in a control population of individuals that have not been diagnosed as having a cancerous condition or signs of infection.
13. A method of treating cancer in a patient, comprising the steps: (1) measuring the level of IL-34 in a sample taken from the patient wherein the sample is selected from the group consisting of blood, serum or plasma, and (2) administering to the patient the antibody or fragment thereof according to claim 1 if the IL-34 levels are higher than IL-34 levels found in blood, serum or plasma in a control population of individuals that have not been diagnosed as having a cancerous condition or signs of infection.