IP Library Granted Patent US 8,440,806
Granted Patent B2
US 8,440,806 · App. 12/392,493 · Granted May 14, 2013

Humanized anti-CD4 antibody with immunosuppressive properties

Inventors: John Wijdenes (Larnod, FR); Helmut Jonuleit (Ginsheim-Gustavsburg, DE)
Assignee: Biotest AG
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 8,440,806
App. No.
12/392,493
Granted
May 14, 2013
Kind
B2
Abstract

A humanized antibody derived from mouse monoclonal anti-CD4 antibody B-F5 is able to activate CD25+CD4+ regulatory T cells and is useful for preparing immunosuppressive compositions.

Claims (26)

1. A polynucleotide encoding a V domain of an antibody, wherein the antibody is a humanized hB-F5antibody, wherein said hB-F5 antibody comprises V domains comprising:

H chain V domain comprising the sequence:

(SEQ ID NO: 1)

EEQLVESGGGLVKPGGSLRLSCAASGFSFSDCRMYWLRQAPGKGLEWIGV

ISVKSENYGANYAESVRGRFTISRDDSKNTVYLQMNSLKTEDTAVYYCSA

SYYRYDVGAWFAYWGQGTLVTVSS; and

L chain V domain comprising the sequence:

(SEQ ID NO: 2)

DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYIYWYQQKPGQPPKL

LIYLASILESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSRELPW

TFGQGTKVEIK,

wherein said hB-F5 antibody is able to activate a subset of CD4 + T cells comprising CD4 + CD25 + regulatory T cells.

2. A polynucleotide selected from the group consisting of

(a) a polynucleotide comprising a sequence encoding for SEQ ID No: 1; and

(b) a polynucleotide comprising a sequence encoding for SEQ ID No: 2.

3. A polynucleotide according to claim 1 or claim 2 , selected from the group consisting of:

(a) a polynucleotide comprising the sequence SEQ ID No: 3; and

(b) a polynucleotide comprising the sequence SEQ ID No: 4.

4. A polynucleotide encoding a V domain of an antibody, wherein the antibody is a humanized anti-CD4 antibody, wherein said humanized anti-CD4 antibody comprises a sequence comprising the complementarity-determining regions (CDRs) of SEQ ID NOs: 10 and 9, displayed in FIGS. 3 and 4 , and wherein the humanized anti-CD4 antibody is capable of activating CD4 + CD25 + regulatory T cells such that the activated CD4 + CD25 + regulatory T cells are able to suppress CD4 + CD45RA+CD25-T cell proliferation in vitro in an allogenic mixed lymphocyte reaction in which the activated CD4 + CD25 + regulatory T cells are cocultured with allogenic CD4 + CD45RA+CD25-T cell in the presence of CD2-depleted peripheral blood mononuclear cells that are syngenic for the CD4 + CD25 + regulatory T cells.

5. A polynucleotide according to claim 4 wherein the humanized anti-CD4 antibody is obtainable from the mouse monoclonal anti-CD4 antibody having V h and V k regions defined by SEQ ID No: 5 and SEQ ID No: 6.

6. An expression vector comprising at least one polynucleotide according to claim 1 .

7. A host cell comprising the expression vector according to claim 6 .

8. A host cell according to claim 7 wherein the cell is a prokaryotic cell.

9. A host cell according to claim 7 wherein the cell is a eukaryotic cell.

10. A host cell according to claim 9 wherein the eukaryotic cell is selected from the group consisting of: plant cell, insect cell, yeast cell or mammalian cell.

11. A polynucleotide according to claim 1 , wherein said subset of CD4+ T cells comprising CD4+CD25+ regulatory T cells are able to suppress CD4 + CD45RA+CD25-T cell proliferation in vitro in an allogenic mixed lymphocyte reaction in which the activated CD4 + CD25 + regulatory T cells are cocultured with allogenic CD4 + CD45RA+CD25-T cell in the presence of CD2-depleted peripheral blood mononuclear cells that are syngenic for the CD4 + CD25 + regulatory T cells.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Aug 30, 2019
From: BIOTEST AG
To: OGEN GMBH
Reel/Frame 050220/0708 →
Priority Claims (2)
EP 03290725 · Mar 21, 2003 · regional
EP 03290942 · Apr 16, 2003 · regional
Continuity (4)
Division 12246660 · Oct 7, 2008
Continuation 11217402 · Sep 2, 2005
Continuation PCTEP2004002888 · Mar 19, 2004
Related Publication 20100291676A1 · Nov 18, 2010