Combinations and uses thereof
The present disclosure describes a pharmaceutical combination of an anti-CD38 antibody and lenalidomide and a pharmaceutical combination of an anti-CD38 antibody and bortezomib.
1. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of:
(i) thalidomide, a thalidomide analog, lenalidomide, or pomalidomide and
(ii) an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).
2. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence SYYMN (SEQ ID NO: 14).
3. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).
4. The method of claim 1 , wherein said antibody comprises a variable heavy chain of the sequence:
(SEQ ID NO: 10)
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVS
GISGDPSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
DLPLVYTGFAYWGQGTLVTVSS;
and a variable light chain of the sequence:
(SEQ ID NO: 11)
DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYG
DSKRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVF
GGGTKLTVLGQ.
5. The method of claim 1 , wherein said antibody is an IgG antibody.
6. The method of claim 1 , wherein said antibody comprises an IgG1 Fc region.
7. The method of claim 1 , wherein said antibody comprises a modified Fc region, wherein said modification enhances ADCC activity.
8. The method of claim 1 , wherein said combination comprises said antibody and thalidomide.
9. The method of claim 8 , wherein said cancer is multiple myeloma.
10. The method of claim 1 , wherein said combination comprises said antibody and lenalidomide.
11. The method of claim 10 , wherein said cancer is multiple myeloma.
12. The method of claim 1 , wherein said combination comprises said antibody and pomalidomide.
13. The method of claim 12 , wherein said cancer is multiple myeloma.
14. The method of claim 1 , wherein said antibody and said thalidomide, thalidomide analog, lenalidomide, or pomalidomide are administered separately.
15. The method of claim 8 , wherein said antibody and said thalidomide are administered separately.
16. The method of claim 10 , wherein said antibody and said lenalidomide are administered separately.
17. The method of claim 12 , wherein said antibody and said pomalidomide are administered separately.
18. The method of claim 9 , wherein said antibody and said thalidomide are administered separately.
19. The method of claim 11 , wherein said antibody and said lenalidomide are administered separately.
20. The method of claim 13 , wherein said antibody and said pomalidomide are administered separately.