Methods for treating cancer using anti-PD-1 antibodies
The present invention provides isolated monoclonal antibodies, particularly human monoclonal antibodies, that specifically bind to PD-1 with high affinity. Nucleic acid molecules encoding the antibodies of the invention, expression vectors, host cells and methods for expressing the antibodies of the invention are also provided. Immunoconjugates, bispecific molecules and pharmaceutical compositions comprising the antibodies of the invention are also provided. The invention also provides methods for detecting PD-1, as well as methods for treating various diseases, including cancer and infectious diseases, using anti-PD-1 antibodies. The present invention further provides methods for using a combination immunotherapy, such as the combination of anti-CTLA-4 and anti-PD-1 antibodies, to treat hyperproliferative disease, such as cancer. The invention also provides methods for altering adverse events related to treatment with such antibodies individually.
1. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody, or an antigen-binding portion thereof, which cross-competes for binding to PD-1 with a reference antibody, or antigen-binding portion thereof, comprising:
(a) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 30; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 51;
(c) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 17; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 24; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 31; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 38; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 45; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 52;
(d) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53;
(e) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 19; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 26; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 33; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 40; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 47; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 54;
(f) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 55; or
(g) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 21; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 28; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 35; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 42; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 49; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 56,
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof exhibits at least one of the following properties:
(i) binds to human PD-1 with a K D of 1×10 −7 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis;
(ii) binds to human PD-1 with an on rate (k on ) of about 0.76×10 5 l/Ms or more, wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis; and
(iii) binds to human PD-1 with an off rate (k off ) of about 4.5×10 l/s or less, wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
2. The method of claim 1 , wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53.
3. The method of claim 1 , wherein the reference antibody or antigen-binding portion thereof comprises:
(a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: I and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 8;
(b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 2 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 9;
(c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 3 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 10;
(d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11;
(e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 12;
(f) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 13; or
(g) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 7 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 14.
4. The method of claim 3 , wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11.
5. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody, or an antigen-binding portion thereof, which binds to the same epitope on human PD-1 as does a reference antibody, or antigen-binding portion thereof, comprising:
(a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: I and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 8;
(b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 2 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 9;
(c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 3 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 10;
(d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11;
(e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 12;
(f) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 13; or
(g) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 7 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 14.
6. The method of claim 5 , wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11.
7. The method of claim 1 , wherein the anti-PD-1 monoclonal antibody, or an antigen-binding portion thereof, comprises a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains; and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains, wherein the heavy chain variable region and light chain variable region CDR3 domains are selected from the group consisting of:
a) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 29; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 50 and or a conservative modification thereof;
b) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 30; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 51 and or a conservative modification thereof;
c) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 52 and or a conservative modification thereof;
d) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53 and or a conservative modification thereof;
e) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 33; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 54 and or a conservative modification thereof;
f) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 34; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 55 and or a conservative modification thereof; and
g) a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 35; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 56 or a conservative modification thereof.
8. The method of claim 7 , wherein the heavy chain variable region and light chain variable region CDR2 domains of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof are selected from the group consisting of:
a) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 22 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 43 and or a conservative modification thereof;
b) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 23 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 44 and or a conservative modification thereof;
c) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 24 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 45 and or a conservative modification thereof;
d) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46 and or a conservative modification thereof;
e) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 26 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 47 and or a conservative modification thereof;
f) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 27 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 48 and or a conservative modification thereof; and
g) a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 28 and or a conservative modification thereof; and a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 49 and or a conservative modification thereof.
9. The method of claim 8 , wherein the heavy chain variable region and light chain variable region CDR1 domains of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof are selected from the group consisting of:
a) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 15 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 36 and or a conservative modification thereof;
b) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 16 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 37 and or a conservative modification thereof;
c) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 17 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 38 and or a conservative modification thereof;
d) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39 and or a conservative modification thereof;
e) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 19 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 40 and or a conservative modification thereof;
f) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 20 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 41 and or a conservative modification thereof; and
g) a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 21 and or a conservative modification thereof; and a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 42 and or a conservative modification thereof.
10. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody, or an antigen-binding portion thereof, comprising:
(a) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 30; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 51;
(c) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 17; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 24; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 31; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 38; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 45; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 52;
(d) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53;
(e) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 19; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 26; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 33; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 40; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 47; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 54;
(f) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 55; or
(g) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 21; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 28; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 35; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 42; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 49; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 56.
11. The method of claim 10 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53.
12. The method of claim 10 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises:
(a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 1 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 8;
(b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 2 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 9;
(c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 3 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 10;
(d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11;
(e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 12;
(f) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 13; or
(g) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 7 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 14.
13. The method of claim 12 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 11.
14. The method of any one of claims 1 , 5 , 7 and 10 , wherein the anti-PD-1 antibody or antigen-binding portion thereof is a humanized or human monoclonal antibody or an antigen-binding portion thereof.
15. The method of any one of claims 1 , 5 , 7 and 10 , wherein the anti-PD-1 antibody or antigen-binding portion thereof further comprises a heavy chain constant region which is of a human IgG1 or IgG4 isotype.
16. The method of claim 13 , wherein the anti-PD-1 antibody or antigen-binding portion thereof comprises a heavy chain constant region which is of a human IgG1 or IgG4 isotype.
17. The method of any one of claims 1 , 5 , 7 and 10 , wherein the anti-PD-1 antibody or antigen-binding portion thereof comprises a light chain constant region which is a human kappa or lambda constant region.
18. The method of claim 13 , wherein the anti-PD-1 antibody or antigen-binding portion thereof comprises a light chain constant region which is a human kappa or lambda constant region.
19. The method of any one of claims 1 , 5 , 7 and 10 , wherein the antigen-binding portion is a Fab, Fab′, F(ab′) 2 , Fv, or a single chain Fv fragment.
20. The method of claim 13 , wherein the antigen-binding portion is a Fab, Fab′, F(ab′) 2 , Fv, or a single chain Fv fragment.
21. The method of any one of claims 1 , 5 , 7 and 10 , wherein the cancer is selected from the group consisting of melanoma, lung cancer, renal cancer, prostate cancer, breast cancer, colorectal cancer, fibrosarcoma, and any combination thereof.
22. The method of any one of claims 1 , 5 , 7 and 10 , wherein the cancer is selected from the group consisting of bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally induced cancers including those induced by asbestos, and combinations of said cancers.
23. The method of any one of claims 3 , 5 , and 12 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a light chain variable region comprising amino acids EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75).
24. The method of any one of claims 3 , 5 , and 12 , wherein the V H of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises V H -FR1, V H -CDR1, V H -FR2, V H -CDR2, V H -FR3, V H -CDR3, and V H -FR4, and the V L comprises V L -FR1, V L -CDR1, V L -FR2, V L -CDR2, V L -FR3, V L -CDR3, and V L -FR4, and wherein the V L -FR1, V L -FR2, and V L -FR3 comprise amino acid sequences derived from a human V K L6 germline sequence and the V L -FR4 comprises an amino acid sequence derived from a human V K JK1 or V K JK4 germline sequence.
25. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody or an antigen-binding portion thereof, which cross-competes for binding to human PD-1 with a reference antibody that comprises:
(a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8;
(b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9;
(c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 11; or
(d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 13;
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof binds to human PD-1 with a K D of 1×10 −8 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis and
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises (i) a light chain variable region, which comprises the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) or EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) containing one amino acid modification and (ii) a heavy chain variable region.
26. The method of claim 25 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof further comprises the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid modification.
27. The method of claim 25 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid modification.
28. The method of claim 25 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid modification.
29. The method of claim 25 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof further comprises the amino acid sequences of WYQQKPGQAPRLLIY (SEQ ID NO: 76) and FGGGTKVEIK (SEQ ID NO: 78).
30. The method of claim 29 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof further comprises a heavy chain comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 82) or WGQGTLVTVSS (SEQ ID NO: 82) containing one amino acid modification.
31. The method of claim 30 , wherein the K D is 1×10 −8 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
32. The method of claim 31 , wherein the K D is 5×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
33. The method of claim 32 , wherein the K D is 1×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
34. The method of claim 25 , which mediates neither ADCC activity nor CDC activity.
35. The method of claim 25 , further comprising a heavy chain constant region which is of a human IgG1, IgG2, IgG3, or IgG4 isotype.
36. The method of claim 25 , wherein the heavy chain constant region is of a human IgG4 isotype.
37. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody or an antigen-binding portion thereof, which cross-competes for binding to human PD-1 with a reference antibody that comprises:
(a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: I and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8;
(b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9;
(c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 4 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 11; or
(d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 13;
wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises a light chain variable region that has at least about 80% sequence identity to an amino acid sequence selected from SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
38. The method of claim 37 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof has at least about 85% sequence identity to an amino acid sequence selected from SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
39. The method of claim 37 , wherein the heavy chain variable region of the reference antibody comprises the amino acid sequence set forth in SEQ ID NO: 4 and the light chain variable region of the reference antibody comprises the amino acid sequence set forth in SEQ ID NO: 11 and wherein the light chain variable region of the monoclonal antibody or the antigen-binding portion thereof has at least about 80% sequence identity to SEQ ID NO: 11.
40. The method of claim 39 , wherein the light chain variable region of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof has at least about 85% sequence identity to SEQ ID NO: 11.
41. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody or an antigen-binding portion thereof, which cross-competes for binding to human PD-1 with a reference antibody that comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 6 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 13; wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises a light chain variable region encoded by a nucleic acid sequence that has at least about 80% sequence identity to the nucleotide sequence set forth in SEQ ID NO: 69.
42. The method of claim 41 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises a light chain variable region encoded by a nucleic acid sequence that has at least about 85% sequence identity to the nucleotide sequence set forth in SEQ ID NO: 69.
43. The method of claim 41 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises a light chain variable region encoded by a nucleic acid sequence that has at least about 90% sequence identity to the nucleotide sequence set forth in SEQ ID NO: 69.
44. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody or an antigen-binding portion thereof, which cross-competes for binding to human PD-1 with a reference antibody comprising a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains selected from the group consisting of:
(a) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
(c) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 53; and
(d) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 55; and
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a heavy chain, which comprises CDR1, CDR2, CDR3, and framework regions, and a light chain, which comprises CDR1, CDR2, CDR3, and framework regions,
wherein the light chain framework regions of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprise amino acids that have at least about 90% sequence identity to the framework regions of a light chain variable region selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11; and
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof exhibits at least one property selected from:
(i) binding to human PD-1 with a K D of 1×10 −7 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis;
(ii) binding to human PD-1 with an on rate (k on ) of about 0.76×10 5 l/Ms or more, wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis; and
(iii) binding to human PD-1 with an off rate (k off ) of about 4.5×10 −4 l/s or less, wherein the off rate (k on ) is measured by surface plasmon resonance (Biacore) analysis.
45. The method of claim 44 , wherein the light chain framework regions of the anti-PD-1 antibody or antigen-binding portion thereof comprise amino acids that have at least about 95% sequence identity to the framework regions of a light chain variable region selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
46. The method of claim 44 , wherein the light chain framework regions of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprise amino acids that have at least about 96% sequence identity to the framework regions of a light chain variable region selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
47. The method of claim 44 , wherein the light chain framework regions of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprise amino acids that have at least about 97% sequence identity to the framework regions of a light chain variable region selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
48. The method of claim 44 , wherein the light chain framework regions of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprise amino acids that have at least about 98% sequence identity to the framework regions of a light chain variable region selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 11.
49. A method for treating a cancer in a subject comprising administering to the subject an anti-PD-1 monoclonal antibody or an antigen-binding portion thereof, which cross-competes for binding to PD-1 with a reference antibody comprising a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains selected from the group consisting of:
(a) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
(c) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 53; and
(d) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 55; and
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a heavy chain, which comprises CDR1, CDR2, CDR3, framework region (FR) 1, FR2, FR3, and FR4, and a light chain, which comprises CDR1, CDR2, CDR3, FR1, FR2, FR3, and FR4,
wherein the light chains FR1, FR2, and FR3 of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprise amino acids derived from the human V K L6 germline sequence and the light chain FR4 of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises an amino acid sequence derived from the human V K JK1 or JK4 germline sequence; and
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof exhibits at least one property selected from:
(i) binding to human PD-1 with a K D of 1×10 −7 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis;
(ii) binding to human PD-1 with an on rate (k on ) of about 0.76×10 5 l/Ms or more, wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis; and
(iii) binding to human PD-1 with an off rate (k off ) of about 4.5×10 −4 l/s or less, wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
50. The method of claim 49 , wherein the light chain FR4 of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises an amino acid sequence derived from the human V K JK4 germline sequence.
51. The method of claim 49 , wherein the light chain FR1 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75).
52. The method of claim 50 , wherein the light chain FR4 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78).
53. The method of claim 44 or 47 , wherein the K D is 1×10 −8 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
54. The method of claim 53 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with a K D of 5×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
55. The method of claim 54 , wherein the K D is 1×10 −9 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
56. The method of claim 47 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with an on rate (k on ) of about 2.56×10 5 l/Ms or more and wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis.
57. The method of claim 47 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with an off rate (k off ) of about 4.5×10 −4 l/s or less and wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
58. The method of claim 1 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises a heavy chain variable region, which comprises framework region (FR) 1, FR2, FR3, and FR4, and a light chain variable region, which comprises FR1, FR2, FR3, and FR4,
wherein the light chain FR1 of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) or EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) containing one amino acid modification;
wherein the light chain FR2 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid modification;
wherein the light chain FR3 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid modification;
wherein the light chain FR4 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid modification;
wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof binds to human PD-1 with a K D of 1×10 −8 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis; and
wherein the administration of the anti-PD-1 monoclonal antibody or antigen-binding portion thereof inhibits tumor growth in the subject.
59. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or antigen-binding portion thereof binds to human PD-1 with a K D of 5×10 −8 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
60. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof binds to human PD-1 with a K D of 5×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
61. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof binds to human PD-1 with a K D of 1×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
62. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof binds to human PD-1 with an on rate (k on ) of about 4.32×10 5 l/Ms or more and wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis.
63. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof binds to human PD-1 with an off rate (k off ) of about 3.15×10 −4 l/s or less and wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
64. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof inhibits the suppression of CD4 + CD25 − T cells by regulatory T cells.
65. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof enhances the antigen specific-memory response to a tumor or a pathogen.
66. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof confers a persistent immunity to tumor relapse.
67. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof increases activation of T cells.
68. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof further comprises a heavy chain constant region which is of a human IgG1, IgG2, IgG3, or IgG4 isotype.
69. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof wherein the heavy chain constant region is of a human IgG4 isotype.
70. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof mediates neither ADCC activity nor CDC activity.
71. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof comprises a light chain constant region which is a human kappa or lambda constant region.
72. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or an antigen-binding portion thereof comprises a light chain constant region which is a human kappa constant region.
73. The method of claim 58 , wherein the heavy chain FR1 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of QVQLVESGGDVVQPGRSLRLSCAASGLTFT (SEQ ID NO: 79) or QVQLVESGGDVVQPGRSLRLSCAASGLTFT (SEQ ID NO: 79) containing one amino acid modification.
74. The method of claim 58 wherein the heavy chain FR2 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 80) or WVRQAPGKGLEWVA (SEQ ID NO: 80) containing one amino acid modification.
75. The method of claim 58 , wherein the heavy chain FR3 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of RFTISRDNSKNTLYLQMNNLRAEDTAVYYCAT (SEQ ID NO: 81) or RFTISRDNSKNTLYLQMNNLRAEDTAVYYCAT (SEQ ID NO: 81) containing one amino acid modification.
76. The method of claim 58 , wherein the heavy chain FR4 of the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 82) or WGQGTLVTVSS (SEQ ID NO: 82) containing one amino acid modification.
77. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding portion thereof is a humanized antibody.
78. The method of claim 58 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding-portion thereof does not substantially bind to human CD28, CTLA-4, or ICOS.
79. The method of claim 1 , wherein the anti-PD-1 monoclonal antibody or the antigen-binding-portion thereof does not substantially bind to human CD28, CTLA-4, or ICOS.