Compositions and methods for treatment and detection of cancers
Pharmaceutical composition comprising antibodies or antigen binding fragments thereof that bind to globo H, SSEA3, and SSEA-4 are disclosed herein, as well as methods of use thereof. Methods of use include, without limitation, cancer therapies and diagnostics. The antibodies of the disclosure can bind to certain cancer cell surfaces. Exemplary targets of the antibodies disclosed herein can include carcinomas, such as those in brain, skin, bone, lungs, breast, esophagus, stomach, liver, bile duct, pancreas, colon, kidney, cervical, ovarian, and/or prostate cancer.
1. An isolated humanized monoclonal antibody that specifically binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3 Galα1→4Galβ1→4Glcβ1, wherein the antibody comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3 wherein
(i) the H-CDR1 comprises the sequence of SEQ ID NO:152 (GFSLTSYG);
(ii) the H-CDR2 comprises the sequence of SEQ ID NO: 153 (IWGEGST);
(iii) the H-CDR3 comprises the sequence of SEQ ID NO:154 (AMTGTAY);
(iv) the L-CDR1 comprises the sequence of SEQ ID NO: 149 (SSVSY);
(v) the L-CDR2 comprises the sequence of SEQ ID NO:150 (DTS); and
(vi) the L-CDR3 comprises the sequence of SEQ ID NO: 151(HQWSSSPHT).
2. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody is an IgG.
3. The isolated humanized monoclonal antibody of claim 2 , wherein the antibody is an IgG1.
4. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody is a glycoantibody and wherein the glycoantibody comprises an N-glycan attached to the Asn-297 of the Fc region of said antibody wherein the N-glycan consists of the structure of Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 and wherein the glycoantibody specifically binds to an SSEA-4 antigen.
5. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody comprises a VH having SEQ ID NO: 147 and a VL having SEQ ID No: 148 or a VH having SEQ ID No:137 and a VL having SEQ ID No:138.
6. A pharmaceutical composition comprising the antibody according to claim 1 .
7. An antigen binding fragment of the isolated humanized monoclonal antibody of claim 1 .
8. The antigen binding fragment of claim 7 , wherein the antigen-binding fragment is an Fab fragment, an F(ab′)2 fragment, or a single-chain Fv fragment.
9. The isolated humanized monoclonal antibody of claim 1 wherein the antibody comprises an H-FR1, an H-FR2, an H-FR3, an H-FR4, an L-FR1, an L-FR2, an L-FR3, and an L-FR4 wherein,
(i) the H-FR1 comprises the sequence of SEQ ID NO:159 (QVQLKESGPGLVAPSQSLSITCTVS);
(ii) the H-FR2 comprises the sequence of SEQ ID NO:160 (VSWIRQPPGKGLEWIGV);
(iii) the H-FR3 comprises the sequence of SEQ ID NO:161 (NYHSVLISRLTISKDNSKSQVFLKLNSLQTDDTATYYC);
(iv) the H-FR4 comprises the sequence of SEQ ID NO:162 (WGQGTLVTVSS);
(v) the L-FR1 comprises the sequence of SEQ ID NO: 155 (QIVLTQSPAIMSASPGEKVTMTCSAS);
(vi) the L-FR2 comprises the sequence of SEQ ID NO:156 (MHWYQQKSGTSPKRWIY);
(vii) the L-FR3 comprises the sequence of SEQ ID NO: 157 (KLSSGVPGRFSGSGSGTSYSLTISRLEAEDAATYYC); and
(viii) the L-FR4 comprises the sequence of SEQ ID NO: 158 (FGGGTKVEIKR).