IP Library Granted Patent US 10,150,818
Granted Patent B2
US 10,150,818 · App. 14/798,312 · Granted Dec 11, 2018

Compositions and methods for treatment and detection of cancers

Inventors: Chi-Huey Wong (Rancho Santa Fe, CA); Tsui-Ling Hsu (New Taipei, TW); Yi-Wei Lou (Taipei, TW); Chih-Wei Lin (Keelung, TW); Shih-Chi Yeh (Taipei, TW); Chung-Yi Wu (New Taipei, TW); Han-Chung Wu (Taipei, TW)
Assignee: Academia Sinica
C07K16/44C07K16/18C07K16/30C07K16/303C07K16/3015C07K16/3023C07K16/3038C07K16/3046C07K16/3053C07K16/3069G01N33/57407G01N33/57484G01N33/57492A61K2039/505C07K2317/21C07K2317/24C07K2317/52C07K2317/565C07K2317/567C07K2317/622C07K2317/734C07K2317/92G01N2400/00G01N2405/10G01N2800/52
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,150,818
App. No.
14/798,312
Granted
Dec 11, 2018
Kind
B2
Abstract

Pharmaceutical composition comprising antibodies or antigen binding fragments thereof that bind to globo H, SSEA3, and SSEA-4 are disclosed herein, as well as methods of use thereof. Methods of use include, without limitation, cancer therapies and diagnostics. The antibodies of the disclosure can bind to certain cancer cell surfaces. Exemplary targets of the antibodies disclosed herein can include carcinomas, such as those in brain, skin, bone, lungs, breast, esophagus, stomach, liver, bile duct, pancreas, colon, kidney, cervical, ovarian, and/or prostate cancer.

Claims (23)

1. An isolated humanized monoclonal antibody that specifically binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3 Galα1→4Galβ1→4Glcβ1, wherein the antibody comprises an H-CDR1, an H-CDR2, an H-CDR3, an L-CDR1, an L-CDR2, and an L-CDR3 wherein

(i) the H-CDR1 comprises the sequence of SEQ ID NO:152 (GFSLTSYG);

(ii) the H-CDR2 comprises the sequence of SEQ ID NO: 153 (IWGEGST);

(iii) the H-CDR3 comprises the sequence of SEQ ID NO:154 (AMTGTAY);

(iv) the L-CDR1 comprises the sequence of SEQ ID NO: 149 (SSVSY);

(v) the L-CDR2 comprises the sequence of SEQ ID NO:150 (DTS); and

(vi) the L-CDR3 comprises the sequence of SEQ ID NO: 151(HQWSSSPHT).

2. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody is an IgG.

3. The isolated humanized monoclonal antibody of claim 2 , wherein the antibody is an IgG1.

4. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody is a glycoantibody and wherein the glycoantibody comprises an N-glycan attached to the Asn-297 of the Fc region of said antibody wherein the N-glycan consists of the structure of Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 and wherein the glycoantibody specifically binds to an SSEA-4 antigen.

5. The isolated humanized monoclonal antibody of claim 1 , wherein the antibody comprises a VH having SEQ ID NO: 147 and a VL having SEQ ID No: 148 or a VH having SEQ ID No:137 and a VL having SEQ ID No:138.

6. A pharmaceutical composition comprising the antibody according to claim 1 .

7. An antigen binding fragment of the isolated humanized monoclonal antibody of claim 1 .

8. The antigen binding fragment of claim 7 , wherein the antigen-binding fragment is an Fab fragment, an F(ab′)2 fragment, or a single-chain Fv fragment.

9. The isolated humanized monoclonal antibody of claim 1 wherein the antibody comprises an H-FR1, an H-FR2, an H-FR3, an H-FR4, an L-FR1, an L-FR2, an L-FR3, and an L-FR4 wherein,

(i) the H-FR1 comprises the sequence of SEQ ID NO:159 (QVQLKESGPGLVAPSQSLSITCTVS);

(ii) the H-FR2 comprises the sequence of SEQ ID NO:160 (VSWIRQPPGKGLEWIGV);

(iii) the H-FR3 comprises the sequence of SEQ ID NO:161 (NYHSVLISRLTISKDNSKSQVFLKLNSLQTDDTATYYC);

(iv) the H-FR4 comprises the sequence of SEQ ID NO:162 (WGQGTLVTVSS);

(v) the L-FR1 comprises the sequence of SEQ ID NO: 155 (QIVLTQSPAIMSASPGEKVTMTCSAS);

(vi) the L-FR2 comprises the sequence of SEQ ID NO:156 (MHWYQQKSGTSPKRWIY);

(vii) the L-FR3 comprises the sequence of SEQ ID NO: 157 (KLSSGVPGRFSGSGSGTSYSLTISRLEAEDAATYYC); and

(viii) the L-FR4 comprises the sequence of SEQ ID NO: 158 (FGGGTKVEIKR).

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 9, 2015
From: WONG, CHI-HUEY; HSU, TSUI-LING; LOU, YI-WEI; LIN, CHIH-WEI; YEH, SHIH-CHI; WU, CHUNG-YI; WU, HAN-CHUNG
To: ACADEMIA SINICA
Reel/Frame 036992/0161 →
Continuity (11)
Continuation In Part PCTUS2015011748 · Jan 16, 2015
Continuation In Part 14599174 · Jan 16, 2015
Continuation In Part PCTUS2015032745 · May 27, 2015
Continuation In Part 14723297 · May 27, 2015
Provisional Application 61928132 · Jan 16, 2014
Provisional Application 62003136 · May 27, 2014
Provisional Application 62003104 · May 27, 2014
Provisional Application 62003908 · May 28, 2014
Provisional Application 62020199 · Jul 2, 2014
Provisional Application 62110338 · Jan 30, 2015
Related Publication 20160102151A1 · Apr 14, 2016