Hypersensitive response elicitor peptides and use thereof
Disclosed are hypersensitive-response eliciting peptides that exhibit improved solubility, stability, resistance to chemical degradation, or a combination of these properties. Use of these peptides or fusion polypeptides, or DNA constructs encoding the same, for modulating plant biochemical signaling, imparting disease resistance to plants, enhancing plant growth, imparting tolerance to biotic stress, imparting tolerance and resistance to abiotic stress, imparting desiccation resistance to cuttings removed from ornamental plants, imparting post-harvest disease or post-harvest desiccation resistance to a fruit or vegetable, or enhancing the longevity of fruit or vegetable ripeness are also disclosed.
1. An isolated peptide that consists essentially of the amino acid sequence of
(L/M)XXLLXXLLXXLL (SEQ ID NO: 25), wherein
X at position 2 can be A, S, T, G, D, isoD, E, γ-glutamate, Q, N, K, or R;
X at position 3 can be Q, A, S, T, G, D, isoD, E, γ-glutamate, N, K, or R;
X at position 6 can be A, S, T, G, D, isoD, E, γ-glutamate, Q, N, K, or R;
X at position 7 can be Q, A, S, T, G, D, isoD, E, γ-glutamate, N, K, or R;
X at position 10 can be K, A, S, T, G, D, isoD, E, γ-glutamate, Q, N, or R; and
X at position 11 can be S, A, T, G, D, isoD, E, γ-glutamate, Q, N, K, or R;
wherein the isolated peptide does not comprise the amino acid sequence of LEELLEELLEELLEE (SEQ ID NO: 213) or TSSSPGLFQSGGDNGLGGHNANSALGQ-QPIDRQTIEQMAQLLAELLKSLL (SEQ ID NO: 162);
wherein the isolated peptide does not contain more than two cationic amino acid residues; and
wherein the isolated peptide, when introduced onto mechanically wounded plant leaf tissue, induces a hypersensitive response.
2. The isolated peptide according to claim 1 , wherein the isolated peptide is either (i) more stable than the polypeptide of SEQ ID NO: 162 when dissolved in water or aqueous solution; or (ii) more resistant to chemical degradation than the polypeptide of SEQ ID NO: 162 when dissolved in an aqueous buffer solution containing a biocide.
3. The isolated peptide according to claim 1 , wherein the peptide is at least 90% pure.
4. The isolated peptide according to claim 1 , wherein the peptide is a fusion polypeptide comprising a second amino acid sequence coupled via peptide bond to the amino acid sequence.
5. The isolated peptide according to claim 4 , wherein the second amino acid sequence includes a purification tag.
6. The isolated peptide according to claim 5 , wherein the second amino acid sequence further includes a cleavable linker sequence between the purification tag and the amino acid sequence.
7. The isolated peptide according to claim 4 , wherein the peptide is a fusion polypeptide comprising a first amino acid sequence for said peptide linked to a second amino acid sequence for said peptide.
8. A fusion polypeptide comprising a plurality of amino acid sequences linked together in series, one of the plurality of amino acid sequences consisting essentially of the peptide according to claim 1 .
9. A composition comprising one or more peptides according to claim 1 and a carrier.
10. The composition according to claim 9 , wherein the composition is a clarified cell extract.
11. The composition according to claim 9 further comprising an additive selected from the group consisting of fertilizer, herbicide, insecticide, fungicide, nematicide, a bactericidal agent, a biological inoculant, a plant regulator, and mixtures thereof.
12. The composition according to claim 11 , wherein the additive comprises either:
(i) clothianidin, a combination of clothianidin and Bacillus firmus , imidicloprid, or a combination of imidicloprid and Bacillus firmus ; or
(ii) thiamethoxam; a combination of thiamethoxam, mefenoxam, and fludioxynil; a combination of thiamethoxam, mefenoxam, fludioxynil and azoxystrobin; a combination of thiamethoxam and abamectin; a combination of thiamethoxam, abamectin, and a Pasteuria nematicide; or a combination of thiamethoxam, mefenoxam, fludioxynil, azoxystrobin, thiabendazole, and abamectin; or
(iii) a biological inoculant comprising a Bradyrhizobium spp., a Bacillus spp., or a combination of a Bradyrhizobium spp. and a Bacillus spp.
13. The composition according to claim 9 , wherein the carrier is an aqueous carrier.
14. The composition according to claim 13 , wherein the aqueous carrier further comprises one or more of a biocidal agent, a protease inhibitor, a non-ionic surfactant, or a combination thereof.
15. The composition according to claim 9 , wherein the carrier is a solid carrier in particulate form.
16. The composition according to claim 15 , wherein the solid carrier is a dry powder.
17. The isolated peptide according to claim 1 further comprising an arginine residue at the C-terminal end.
18. The isolated peptide according to claim 1 , wherein
X at position 2 is A, S, T, G, D, isoD, E, γ-glutamate, Q, or N;
X at position 3 is Q, A, S, T, G, D, isoD, E, γ-glutamate, or N;
X at position 6 is A, S, T, G, D, isoD, E, γ-glutamate, Q, or N;
X at position 7 is Q, A, S, T, G, D, isoD, E, γ-glutamate, or N;
X at position 10 is A, S, T, G, D, isoD, E, γ-glutamate, Q, or N; and
X at position 11 is S, A, T, G, D, isoD, E, g-glutamate, Q, or N.
19. A method of imparting disease resistance to plants comprising:
applying an effective amount of an isolated peptide according to claim 1 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to impart disease resistance.
20. A method of enhancing plant growth comprising:
applying an effective amount of an isolated peptide according to claim 1 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to enhance plant growth.
21. A method of increasing a plant's tolerance to biotic stress comprising:
applying an effective amount of an isolated peptide according to claim 1 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to biotic stress factors selected from the group consisting of insects, arachnids, nematodes, weeds, and combinations thereof.
22. A method of increasing a plant's tolerance to abiotic stress comprising:
applying an effective amount of an isolated peptide according to claim 1 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to abiotic stress factors selected from the group consisting of salt stress, water stress, ozone stress, heavy metal stress, cold stress, heat stress, nutritional stress, and combinations thereof.
23. An isolated peptide that consists essentially of the amino acid sequence of (L/M)XXLLXXLLXXLL (SEQ ID NO: 25) wherein
X at positions 2, 3, 6, 7, 10, and 11 are independently selected from the group consisting of A, S, T, G, D, isoD, E, γ-glutamate, Q, N, K, and R;
the peptide further comprises a solubility tag sequence, located N- or C-terminal of SEQ ID NO: 25, whereby the peptide has an average Kyte-Doolittle hydropathy index of less than 0.3;
the isolated peptide does not contain more than two cationic amino acid residues;
the isolated peptide does not comprise the amino acid sequence of LEELLEELLEELLEE (SEQ ID NO: 213); and
wherein the isolated peptide, when introduced onto mechanically wounded plant leaf tissue, induces a hypersensitive response.
24. The isolated peptide according to claim 23 , wherein X at positions 2, 3, 6, 7, 10, and 11 are independently selected from the group consisting of A, S, T, G, D, isoD, E, γ-glutamate, Q, and N.
25. The isolated peptide according to claim 24 , wherein the isolated peptide further comprises a C-terminal Arg or Lys residue.
26. An isolated peptide selected from the group consisting of:
(i) a peptide that is up to 50 amino acids in length and comprises the amino acid sequence of one of SEQ ID NOS: 81-88, 119, 163-167, 228, 229, and 231 and
(ii) a peptide that comprises the amino acid sequence of one of SEQ ID NOs: 81-88, 119, 163-167, 228, 229, and 231, except that (i) any lysine or arginine residues are changed to glutamate and (ii) an arginine residue is introduced at the C-terminal end of the peptide.
27. The isolated peptide according to claim 26 , wherein the isolated peptide comprises the amino acid sequence of QQPIDRQTIEQMAQLLAQLLKSLLSPQ (SEQ ID NO: 83).
28. The isolated peptide according to claim 27 , wherein the isolated peptide comprises the amino acid sequence of QQPIDRQTIEQMAQLLAQLLKSLLSPQ (SEQ ID NO: 83) except that the Arg residue at position 6 and the Lys residue at position 21 are changed to Glu, and an Arg residue is introduced at the C-terminal end.
29. The isolated peptide according to claim 26 , wherein the isolated peptide comprises the amino acid sequence of one of SEQ ID NOS: 81-88, 119, 163-167, 228, 229, and 231.
30. The isolated peptide according to claim 1 , wherein the peptide has an average Kyte-Doolittle hydropathy index of less than 0.3.
31. The isolated peptide according to claim 1 , wherein the peptide has an average Kyte-Doolittle hydropathy index of less than 0.1.
32. The isolated peptide according to claim 23 , wherein the peptide has an average Kyte-Doolittle hydropathy index of less than 0.1.
33. A fusion polypeptide comprising a plurality of amino acid sequences linked together in series, one of the plurality of amino acid sequences comprising the peptide according to claim 23 .
34. A composition comprising one or more peptides according to claim 23 and a carrier.
35. A method of imparting disease resistance to plants comprising: applying an effective amount of an isolated peptide according to claim 23 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to impart disease resistance.
36. A method of enhancing plant growth comprising: applying an effective amount of an isolated peptide according to claim 23 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to enhance plant growth.
37. A method of increasing a plant's tolerance to biotic stress comprising:
applying an effective amount of an isolated peptide according to claim 23 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to biotic stress factors selected from the group consisting of insects, arachnids, nematodes, weeds, and combinations thereof.
38. A method of increasing a plant's tolerance to abiotic stress comprising:
applying an effective amount of an isolated peptide according to claim 23 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to abiotic stress factors selected from the group consisting of salt stress, water stress, ozone stress, heavy metal stress, cold stress, heat stress, nutritional stress, and combinations thereof.
39. A fusion polypeptide comprising a plurality of amino acid sequences linked together in series, one of the plurality of amino acid sequences comprising the peptide according to claim 26 .
40. A composition comprising one or more peptides according to claim 26 and a carrier.
41. A method of imparting disease resistance to plants comprising: applying an effective amount of an isolated peptide according to claim 26 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to impart disease resistance.
42. A method of enhancing plant growth comprising: applying an effective amount of an isolated peptide according to claim 26 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to enhance plant growth.
43. A method of increasing a plant's tolerance to biotic stress comprising:
applying an effective amount of an isolated peptide according to claim 26 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to biotic stress factors selected from the group consisting of insects, arachnids, nematodes, weeds, and combinations thereof.
44. A method of increasing a plant's tolerance to abiotic stress comprising:
applying an effective amount of an isolated peptide according to claim 26 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to abiotic stress factors selected from the group consisting of salt stress, water stress, ozone stress, heavy metal stress, cold stress, heat stress, nutritional stress, and combinations thereof.