IP Library Granted Patent US 10,906,968
Granted Patent B2
US 10,906,968 · App. 16/033,353 · Granted Feb 2, 2021

Polynucleotides encoding optimized variants of anti-VEGF antibodies

Inventors: Patrick Koenig (San Francisco, CA); Chingwei Vivian Lee (Foster City, CA); Karthikan Rajagopal (South San Francisco, CA); Amin Famili (South San Francisco, CA); Germaine Fuh (Pacifica, CA)
Assignee: Genentech, Inc.
C07K16/22A61K39/3955A61K47/34A61K47/60A61K47/61C07K14/475C07K16/44C07K16/468C12N15/1037C12N15/115A61K2039/505A61K2039/54C07K2317/14C07K2317/21C07K2317/24C07K2317/31C07K2317/55C07K2317/56C07K2317/565C07K2317/567C07K2317/76C07K2317/90C07K2317/92C07K2317/94C07K2318/20C07K2319/30C07K2319/31C12N2310/16
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,906,968
App. No.
16/033,353
Granted
Feb 2, 2021
Kind
B2
Abstract

The present invention provides anti-VEGF antibodies and compositions that include anti-VEGF antibodies (e.g., antibody conjugates, fusion proteins, and polymeric formulations), and uses thereof, for example for treatment of disorders associated with pathological angiogenesis. The present invention also provides methods of identifying antibody variants with improved properties, for example, enhanced binding affinity, stability, pharmacokinetics, and/or expression.

Claims (73)

1. A polynucleotide encoding an antibody that specifically binds vascular endothelial growth factor (VEGF), wherein the antibody comprises the following six hypervariable regions (HVRs):

(a) an HVR-H1 comprising the amino acid sequence of DYWIH (SEQ ID NO: 1);

(b) an HVR-H2 comprising the amino acid sequence of GX 1 TPX 2 GGX 3 X 4 X 5 YX 6 DSVX 7 X 8 (SEQ ID NO: 2), wherein X 1 is Ile or His, X 2 is Ala or Arg, X 3 is Tyr or Lys, X 4 is Thr or Glu, X 3 is Arg, Tyr, Gln, or Glu, X 6 is Ala or Glu, X 7 is Lys or Glu, and X 8 is Gly or Glu;

(c) an HVR-H3 comprising the amino acid sequence of FVFFLPYAMDY (SEQ ID NO: 3);

(d) an HVR-L1 comprising the amino acid sequence of RASQX 1 VSTAVA (SEQ ID NO: 4), wherein X 1 is Asp or Arg;

(e) an HVR-L2 comprising the amino acid sequence of X 1 ASFLYS (SEQ ID NO: 5), wherein X 1 is Ser or Met; and

(f) an HVR-L3 comprising the amino acid sequence of X 1 QGYGX 2 PFT (SEQ ID NO: 6), wherein X 1 is Gln, Asn, or Thr and X 2 is Ala, Gln, or Arg.

2. The polynucleotide of claim 1 , wherein the antibody comprises the following six HVRs:

(a) an HVR-H1 comprising the amino acid sequence of DYWIH (SEQ ID NO: 1);

(b) an HVR-H2 comprising the amino acid sequence of GITPAGGYTRYADSVKG (SEQ ID NO: 7), GITPAGGYEYYADSVKG (SEQ ID NO: 21), or GITPAGGYEYYADSVEG (SEQ ID NO: 22);

(c) an HVR-H3 comprising the amino acid sequence of FVFFLPYAMDY (SEQ ID NO: 3);

(d) an HVR-L1 comprising the amino acid sequence of RASQDVSTAVA (SEQ ID NO: 8);

(e) an HVR-L2 comprising the amino acid sequence of SASFLYS (SEQ ID NO: 9); and

(f) an HVR-L3 comprising the amino acid sequence of QQGYGAPFT (SEQ ID NO: 10).

3. The polynucleotide of claim 2 , wherein the antibody comprises the following six HVRs:

(a) an HVR-H1 comprising the amino acid sequence of DYWIH (SEQ ID NO: 1);

(b) an HVR-H2 comprising the amino acid sequence of GITPAGGYTRYADSVKG (SEQ ID NO: 7);

(c) an HVR-H3 comprising the amino acid sequence of FVFFLPYAMDY (SEQ ID NO: 3);

(d) an HVR-L1 comprising the amino acid sequence of RASQDVSTAVA (SEQ ID NO: 8);

(e) an HVR-L2 comprising the amino acid sequence of SASFLYS (SEQ ID NO: 9); and

(f) an HVR-L3 comprising the amino acid sequence of QQGYGAPFT (SEQ ID NO: 10).

4. The polynucleotide of claim 3 , wherein the antibody further comprises the following heavy chain variable (VH) domain framework regions (FRs):

(a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13);

(b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 14);

(c) an FR-H3 comprising the amino acid sequence of RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); and

(d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 16).

5. The polynucleotide of claim 4 , wherein the antibody further comprises the following light chain variable (VL) domain FRs:

(a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17);

(b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 18);

(c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); and

(d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 20).

6. A polynucleotide encoding an antibody that specifically binds VEGF, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 11 and (b) a VL domain comprising an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 12, wherein the antibody comprises the following six HVRs:

(a) an HVR-H1 comprising the amino acid sequence of DYWIH (SEQ ID NO: 1);

(b) an HVR-H2 comprising the amino acid sequence of GITPAGGYTRYADSVKG (SEQ ID NO: 7);

(c) an HVR-H3 comprising the amino acid sequence of FVFFLPYAMDY (SEQ ID NO: 3);

(d) an HVR-L1 comprising the amino acid sequence of RASQDVSTAVA (SEQ ID NO: 8);

(e) an HVR-L2 comprising the amino acid sequence of SASFLYS (SEQ ID NO: 9); and

(f) an HVR-L3 comprising the amino acid sequence of QQGYGAPFT (SEQ ID NO: 10).

7. The polynucleotide of claim 6 , wherein the VH domain further comprises the following FRs:

(a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13);

(b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 14) or WVRQEPGKGLEWVA (SEQ ID NO: 39);

(c) an FR-H3 comprising the amino acid sequence of RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); and

(d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 16).

8. The polynucleotide of claim 7 , wherein the VH domain comprises the amino acid sequence of SEQ ID NO: 11.

9. The polynucleotide of claim 6 , wherein the VL domain further comprises the following FRs:

(a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17) or DIQMTQSPSSLSASVGDRVTIDC (SEQ ID NO: 45);

(b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 18);

(c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19), GVPSRFSGSGSGTDFTLTISSLQPEDSATYYC (SEQ ID NO: 44), or GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 54); and

(d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 20) or FGQGTKVEVK (SEQ ID NO: 55).

10. The polynucleotide of claim 9 , wherein the VL domain comprises the amino acid sequence of SEQ ID NO: 12.

11. A polynucleotide encoding an antibody that specifically binds VEGF, wherein the antibody comprises (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 11 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 12.

12. A polynucleotide encoding an antibody that specifically binds VEGF, wherein the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 48 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 50.

13. A polynucleotide encoding an antibody that specifically binds VEGF, wherein the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 49 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 50.

14. The polynucleotide of claim 1 , wherein the antibody is capable of inhibiting the binding of VEGF to a VEGF receptor.

15. The polynucleotide of claim 14 , wherein the VEGF receptor is VEGF receptor 1 (Flt-1) or VEGF receptor 2 (KDR).

16. The polynucleotide of claim 1 , wherein the antibody binds human VEGF (hVEGF) with a Kd of between about 75 pM and about 2 nM; has a melting temperature (Tm) of greater than about 83.5° C.; and/or has an isoelectric point (pI) of lower than 8.

17. The polynucleotide of claim 1 , wherein the antibody is monoclonal, human, humanized, or chimeric.

18. The polynucleotide of claim 1 , wherein the antibody is an antibody fragment that binds VEGF.

19. The polynucleotide of claim 18 , wherein the antibody fragment is selected from the group consisting of Fab, Fab-C, Fab′-SH, Fv, scFv, and (Fab′) 2 fragments.

20. The polynucleotide of claim 1 , wherein the antibody is a monospecific antibody.

21. The polynucleotide of claim 1 , wherein the antibody is a multispecific antibody.

22. The polynucleotide of claim 21 , wherein the multispecific antibody is a bispecific antibody.

23. A vector comprising the polynucleotide of claim 1 .

24. An isolated host cell comprising the vector of claim 23 .

25. The isolated host cell of claim 24 , wherein the host cell is prokaryotic.

26. The isolated host cell of claim 25 , wherein the host cell is Escherichia coli.

27. The isolated host cell of claim 24 , wherein the host cell is eukaryotic.

28. The isolated host cell of claim 27 , wherein the host cell is a 293 cell, a CHO cell, a yeast cell, or a plant cell.

29. A method of producing an antibody that specifically binds to VEGF, the method comprising culturing a host cell that comprises the vector of claim 23 and recovering the antibody.

30. The method of claim 29 , wherein the host cell is prokaryotic.

31. The method of claim 30 , wherein the host cell is Escherichia coli.

32. The method of claim 29 , wherein the host cell is eukaryotic.

33. The method of claim 32 , wherein the host cell is a 293 cell, a CHO cell, a yeast cell, or a plant cell.

Continuity (4)
Division 15274612 · Sep 23, 2016
Provisional Application 62271913 · Dec 28, 2015
Provisional Application 62222698 · Sep 23, 2015
Related Publication 20190031750A1 · Jan 31, 2019
Cited By (1)
US 12,570,733