Anti-senescence compounds and uses thereof
View Patent ↗The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.
1. A peptide comprising the amino acid sequence of SEQ ID NO:6, wherein all of the amino acids in said peptide are D-amino acid residues.
2. The peptide according to claim 1 , further comprising a cell-penetrating peptide sequence.
3. The peptide according to claim 2 , wherein said cell-penetrating peptide is fused to the C-terminal part of said peptide.
4. A pharmaceutical composition comprising a peptide according to claim 1 , optionally further comprising a chemotherapeutic agent.
5. A method of inducing apoptosis in a senescent cell, the method comprising providing the peptide of claim 1 to said senescent cell.
6. The peptide according to claim 2 , wherein said cell-penetrating peptide sequence has the amino acid sequence of SEQ ID NO:1.
7. The peptide according to claim 2 , wherein all of the amino acids in said cell-penetrating peptide sequence are D-amino acid residues.
8. The peptide of claim 1 , wherein said peptide exhibits apoptosis-inducing activity in senescent cells.