Chimeric peptides comprising HER-2 B-cell epitopes and measles virus fusion protein T-cell epitopes
View Patent ↗Compositions, methods, and vaccines that may stimulate the immune system and that may be used for treating malignancies associated with overexpression of the HER-2 protein are provided. Such compositions include epitopes of the HER-2 proteins.
1. An immunogenic composition comprising a chimeric peptide, wherein the chimeric peptide comprises a HER-2 B epitope, a T helper (Th) epitope, and a linker joining the HER-2 B epitope to the Th epitope, wherein:
the HER-2 B epitope consists of LHCPALVTYNTDTFESMPNPEGRYTFGASCV (SEQ ID NO: 6);
the Th epitope comprises KLLSLIKGVIVHRLEGVE (SEQ ID NO: 10); and
the linker is of from 1 to 15 amino acids.
2. The composition as claimed in claim 1 wherein at least one of the HER-2 B epitope, the Th epitope, or the linker is in retro-inverso form.
3. The composition as claimed in claim 1 wherein the linker comprises 2 to 15 amino acids.
4. The composition as claimed in claim 1 wherein the linker comprises GPSL (SEQ ID NO: 18).
5. The composition as claimed in claim 1 wherein the Th epitope has a sequence of NSVDDALINSTIYSYFPSV (SEQ ID NO: 11).
6. The composition as claimed in claim 1 wherein the Th epitope has a sequence of PGINGKAIHLVNNQSSE (SEQ ID NO: 12).
7. The composition as claimed in claim 1 wherein the Th epitope has a sequence of QYIKANSKFIGITEL (SEQ ID NO: 13).
8. The composition as claimed in claim 1 wherein the Th epitope has a sequence of FNNFTVSFWLRVPKVSASHLE (SEQ ID NO: 14).
9. The composition as claimed in claim 1 wherein the Th epitope has a sequence of LSEIKGVIVHRLEGV (SEQ ID NO: 15).
10. The composition as claimed in claim 1 wherein the Th epitope has a sequence of FFLLTRILTIPQSLN (SEQ ID NO: 16).
11. The composition as claimed in claim 1 wherein the Th epitope has a sequence of TCGVGVRVRSRVNAANKKPE (SEQ ID NO: 17).
12. A method of stimulating an immune response in a subject comprising administering to said subject the composition of claim 1 .