IP Library Granted Patent US 8,557,591
Granted Patent B2
US 8,557,591 · App. 13/673,932 · Granted Oct 15, 2013

Methods for assaying percentage of glycated hemoglobin

Inventors: Chong-Sheng Yuan (San Diego, CA); Abhijit Datta (Carlsbad, CA); Limin Liu (San Diego, CA)
Assignee: General Atomics
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 8,557,591
App. No.
13/673,932
Granted
Oct 15, 2013
Kind
B2
Abstract

The invention provides enzymatic methods for direct determination of percentage of glycated hemoglobin in blood samples without the need of a separated measurement of total hemoglobin content in blood samples. The methods utilizes one or two different types of oxidizing agents which selectively oxidize low-molecular weight reducing substances and high-molecular weight (mainly hemoglobin) reducing substances in blood samples, coupled with enzymatic reactions catalyzed by proteases, fructosyl amino acid oxidase. The amount of hydrogen peroxide generated in the reaction is measured for determination of percentage of glycated hemoglobin in blood samples. The invention provides kits for performing the methods of the invention.

Claims (43)

1. A method for directly assaying percentage of glycated hemoglobin A1c in a blood sample without measuring the total hemoglobin in the blood sample in a separate process, said method comprising:

a) contacting protein fragments containing glycated peptides or glycated amino acids with a fructosyl amino acid oxidase to generate hydrogen peroxide (H 2 O 2 ), wherein the protein fragments are generated by contacting the blood sample with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes low molecular weight reducing substances; 3) a second oxidizing agent which selectively oxidizes high molecular weight reducing substances, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids;

b) measuring the amount of H 2 O 2 generated in step a); and

c) determining percentage of glycated hemoglobin A1c in the sample by correlating the measured value of H 2 O 2 in step b) to a percentage of glycated hemoglobin A1c using a calibration curve without measuring the total hemoglobin in the blood sample separately.

2. The method of claim 1 , wherein the amount of H 2 O 2 generated in step a) is measured by an electrochemical biosensor to generate a measurable signal.

3. The method of claim 1 , wherein the amount of H 2 O 2 generated in step a) is measured by contacting said H 2 O 2 with a color forming substance in the presence of a peroxidase to generate a measurable signal.

4. The method of claim 3 , wherein the color forming substance is N-Carboxymethylaminocarbonyl)-4,4′-bis(dimethylamino)-diphenylamine sodium salt (DA-64), N,N,N′N′,N″,N″-Hexa(3-sulfopropyl)-4,4′,4″,-triamino-triphenylmethane hexasodium salt (TPM-PS), or 10-(carboxymethylaminocarbonyl)-3,7-bis(dimethylamino)-phenothiazine sodium salt (DA-67).

5. The method of claim 3 , wherein the peroxidase is horseradish peroxidase.

6. The method of claim 1 , wherein the first oxidizing agent is Dess-Martin periodinane or N-ethylmaleimide, and wherein the second oxidizing agent is a tetrazolium salt.

7. The method of claim 4 , wherein tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.

8. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent or the second oxidizing agent.

9. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent and the second oxidizing agent.

10. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent, the second oxidizing agent, and the protease.

11. The method of claim 1 , wherein the lysing buffer contains the protease.

12. The method of claim 1 , wherein the first oxidizing agent and the second oxidizing agent are formulated in a single composition.

13. The method of claim 1 , wherein the first oxidizing agent and the second oxidizing agent are formulated in a separate composition.

14. The method of claim 1 , wherein the protease is formulated in a single composition with the first oxidizing agent or the second oxidizing agent.

15. The method of claim 1 , wherein the first oxidizing agent, the second oxidizing agent, and the protease are formulated in a single composition.

16. The method of claim 1 , wherein the fructosyl amino acid oxidase, the peroxidase, and the color forming substance are formulated in a single composition.

17. The method of claim 1 , wherein the blood sample is a whole blood or collected blood cells.

18. The method of claim 1 , wherein the protease is an endo-type protease or an exo-type protease.

19. The method of claim 1 , wherein the protease is selected from the group consisting of proteinase K, pronase E, ananine, thermolysin, subtilisin and cow pancreas proteases.

20. The method of claim 1 , wherein the protease is a neutral protease of Aspergillus or Bacillus origin.

21. The method of claim 1 , wherein the protease generates a glycated peptide from about 2 to about 30 amino acid residues.

22. The method of claim 1 , wherein the protease generates glycated glycine, glycated valine or glycated lysine residue or a glycated peptide comprising glycated glycine, glycated valine or glycated lysine residue.

23. The method of claim 1 , wherein the protein fragments containing the glycated peptide or glycated amino acid are contacted with the fructosyl amino acid oxidase and the peroxidase sequentially or simultaneously.

24. The method of claim 1 , wherein the fructosyl amino acid oxidase comprises the amino acid sequence set forth in SEQ ID NO:1

(MGGSGDDDDLALAVTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGN

DVNKVISSGQYSNNKDEIEVNEILAEEAFNGWKNDPLFKPYYHDTGLLMSACSQEGLDRLG

VRVRPGEDPNLVELTRPEQFRKLAPEGVLQGDFPGWKGYFARSGAGWAHARNALVAAAR

EAQRMGVKFVTGTPQGRVVTLIFENNDVKGAVTGDGKIWRAERTFLCAGASAGQFLDFK

NQLRPTAWTLVHIALKPEERALYKNIPVIFNIERGFFFEPDEERGEIKICDEHPGYTNMVQSA

DGTMMSIPFEKTQIPKEAETRVRALLKETMPQLADRPFSFARICWCADTANREFLIDRHPQY

HSLVLGCGASGRGFKYLPSIGNLIVDAMEGKVPQKIHELIKWNPDIAANRNWRDTLGRFGG

PNRVMDFHDVKEWTNVQYRDISKLKGELEGLPIPNPLLRTGHHHHHH).

25. The method of claim 1 , which is used in the prognosis or diagnosis of a disease or disorder.

26. The method of claim 25 , wherein the disease or disorder is diabetes.

27. The method of claim 1 , wherein the first oxidizing agent is selected from the group consisting of Dess-Martin periodinane, N-ethyl maleimide, sodium iodoacetate, sodium periodate, and Chloramine-T.

28. The method of claim 1 , wherein the second oxidizing agent is selected from the group consisting of a tetrazolium salt, sodium dodecyl sulfate, potassium ferricyanide (III), and potassium iodate.

29. The method of claim 1 , wherein the fructosyl amino acid oxidase is a functional fragment or a derivative of a fructosyl amino acid oxidase comprising the amino acid sequence set forth in SEQ ID NO:1, wherein the functional fragment or the derivative retains at least 90% of the activity of the fructosyl amino acid oxidase comprising the amino acid sequence set forth in SEQ ID NO:1.

30. The method of claim 29 , wherein the functional fragment or the derivative retains at least 95% of the activity of the fructosyl amino acid oxidase comprising the amino acid sequence set forth in SEQ ID NO:1.

31. The method of claim 29 , wherein the derivative comprising the amino acid sequence of SEQ ID NO:1 with one or more conservative amino acid substitutions.

32. The method of claim 1 , wherein the fructosyl amino acid oxidase is a chimeric protein comprising a first peptidyl fragment comprising a bacterial leader sequence from about 5 to about 30 amino acid residues and a second peptidyl fragment comprising an amino acid sequence set forth in residues 13-449 of SEQ ID NO:1.

Assignments (2)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Mar 8, 2017
From: GENERAL ATOMICS
To: DIAZYME LABORATORIES, INC.
Reel/Frame 041921/0822 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jun 11, 2013
From: YUAN, CHONG-SHENG; DATTA, ABHIJIT; LIU, LIMIN
To: GENERAL ATOMICS
Reel/Frame 030591/0258 →
Continuity (6)
Continuation 13083357 · Apr 8, 2011
Continuation 12120122 · May 13, 2008
Continuation In Part 11881179 · Jul 25, 2007
Provisional Application 60833390 · Jul 25, 2006
Provisional Application 60858809 · Nov 13, 2006
Related Publication 20130078664A1 · Mar 28, 2013