Plasminogen receptor, polypeptides and antibodies thereof
The invention relates to C9orf46 homolog, a novel murine membrane protein, and its orthologs in human, mouse and all other species, termed Plg-R KT , or analogs, thereof and the isolation method. The function of this molecule is to bind to plasminogen, plasminogen fragments such as angiostatin 1 and other plasminongen fragments having angiostatic activity, tissue plasminogen activator and Lipoprotein(a). Plasminogen receptors function to modulate cell surface proteolysis and physiological and pathophysiological processes requiring cell migration, including, but not limited to, cell migration during inflammation, tissue remodeling, wound healing, tumor cell invasion and metastasis, skeletal myogenesis, neurite outgrowth. Plasminogen receptors also modulate apoptosis and cell death. The invention also relates to antibodies that inhibit plasminogen, plasminogen fragments such as angiostatin 1 and other plasminongen fragments having angiostatic activity, tissue plasminogen activator or Lipoprotein(a) binding to Plg-R KT and/or immunoreact with Plg-R KT .
1. An isolated antibody that immunoreacts with a Plasminogen Receptor KT (Plg-R KT ) polypeptide, the amino acid sequence of which comprises the sequence: KEQSRFFIDK (SEQ ID NO:49), CEQSRFFIDK (SEQ ID NO:50), RFFIDK (SEQ ID NO:51), LFSDK (SEQ ID NO:20), REQSKLFSDK (SEQ ID NO: 52), KARKEQSRFFIDK (SEQ ID NO:53), RGMITFESIEKARKEQSRFFIDK (SEQ ID NO:54), KLQLPRGMITFESIEKARKEQSRFFIDK (SEQ ID NO:55), RMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK (SEQ ID NO:56), RKEQSRFFIDK (SEQ ID NO:57), or MGFIFSKSMNENMKNQQEFM (SEQ ID NO:25); wherein the isolated antibody does not immunoreact with a polypeptide comprising the amino acid sequence
(SEQ ID NO 31)
AFLVPIVPLSFIFTYQYDLG.
2. The antibody of claim 1 , which is a monoclonal antibody.
3. A therapeutic composition comprising the antibody of claim 1 and a pharmaceutically acceptable excipient.