IP Library › Granted Patent US 9,446,116
Granted Patent B2
US 9,446,116 · App. 13/906,232 · Granted Sep 20, 2016

Peptide sequences and compositions

Inventors: Gregory Alan Stoloff (London, GB); Wilson Romero Caparros-Wanderley (London, GB)
Assignee: PepTCell Limited
A61K39/145A61K39/12C07K7/08C07K14/005C07K14/11A61K2039/55566A61K2039/57A61K2039/70C12N2760/16122C12N2760/16134C12N2760/16222C12N2760/16234
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 9,446,116
App. No.
13/906,232
Granted
Sep 20, 2016
Kind
B2
Abstract

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Claims (39)

1. An immunogenic composition, the composition comprising an adjuvant, an isolated polypeptide that elicits an immune response against an influenza and one or more additional isolated polypeptides;

wherein the isolated polypeptide is SEQ ID NO: 1, a fragment of SEQ ID NO: 1 having 7 or more consecutive amino acids from SEQ ID NO: 1, or a consensus polypeptide consisting of a sequence having 85% or more amino acid sequence identity to SEQ ID NO: 1, and

wherein the one or more additional polypeptides are SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 6, a fragment having 7 or more consecutive amino acids of SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 6, or a consensus polypeptide having 85% or more amino acid sequence identity to SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 6.

2. The composition according to claim 1 , wherein the composition is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele.

3. The composition according to claim 2 , wherein the vertebrate is a mammal, a bird, a reptile, or a fish.

4. The composition according to claim 2 , wherein the vertebrate is a domestic animal, a farm animal, a bovine animal, or a fowl.

5. The composition according to claim 2 , wherein the vertebrate is a chicken, a duck, a goose, a pig, a horse, a cow, a dog, a cat, or a human.

6. The composition according to claim 1 , which is immunogenic to an influenza virus strain.

7. The composition according to claim 1 , which is immunogenic to a plurality of influenza virus strains.

8. The composition according to claim 1 , wherein the isolated polypeptide comprises a cytotoxic T lymphocyte (CTL) epitope.

9. The composition according to claim 8 , wherein the CTL epitope has 8, 9 10 or 11 amino acids or more.

10. The composition according to claim 1 , wherein the isolated polypeptide is in a dose of 1 μg to 100 g.

11. The composition according to claim 1 , wherein the influenza is an influenza A strain.

12. The composition according to claim 1 , wherein the influenza is an influenza B strain.

13. The composition according to claim 1 , further comprising a carrier.

14. The composition of claim 13 , wherein the carrier comprises an excipient.

15. The composition according to claim 1 , wherein the composition is administered subcutaneously, intramuscularly, intravenously, intradermally, intranasally or orally.

16. The composition according to claim 1 , wherein the composition is in the form of a pill or a liquid preparation.

17. The composition according to claim 1 , wherein the composition comprises

SEQ ID NO: 1, a fragment of SEQ ID NO: 1 having 9 or more consecutive amino acids from SEQ ID NO: 1 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 1;

SEQ ID NO: 3, a fragment of SEQ ID NO: 3 having 9 or more consecutive amino acids from SEQ ID NO: 3 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 3;

SEQ ID NO: 4, a fraqment of SEQ ID NO: 4 having 9 or more consecutive amino acids from SEQ ID NO: 4 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 4; and

SEQ ID NO: 6, a fragment of SEQ ID NO: 6 having 9 or more consecutive amino acids from SEQ ID NO: 6 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 6.

18. The composition according to claim 17 , wherein the composition comprises

SEQ ID NO: 1, a fragment of SEQ ID NO: 1 having 11 or more consecutive amino acids from SEQ ID NO: 1 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 1;

SEQ ID NO: 3, a fragment of SEQ ID NO: 3 having 11 or more consecutive amino acids from SEQ ID NO: 3 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 3;

SEQ ID NO: 4, a fragment of SEQ ID NO: 4 having 11 or more consecutive amino acids from SEQ ID NO: 4 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 4; and

SEQ ID NO: 6, a fragment of SEQ ID NO: 6 having 11 or more consecutive amino acids from SEQ ID NO: 6 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 6.

19. The composition according to claim 1 , wherein the composition comprises

SEQ ID NO: 1 or a consensus polypeptide consisting of a sequence having 85% or more amino acid sequence identity to SEQ ID NO: 1;

SEQ ID NO: 3 or a consensus polypeptide consisting of a sequence having 85% or more amino acid sequence identity to SEQ ID NO: 3;

SEQ ID NO: 4 or a consensus polypeptide consisting of a sequence having 85% or more amino acid sequence identity to SEQ ID NO: 4; and

SEQ ID NO: 6 or a consensus polypeptide consisting of a sequence having 85% or more amino acid sequence identity to SEQ ID NO: 6.

20. The composition according to claim 19 , wherein the composition comprises

SEQ ID NO: 1 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 1;

SEQ ID NO: 3 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 3;

SEQ ID NO: 4 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 4; and

SEQ ID NO: 6 or a consensus polypeptide consisting of a sequence having 95% or more amino acid sequence identity to SEQ ID NO: 6.

21. The composition according to claim 20 , wherein the composition comprises SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 6.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 8, 2016
From: STOLOFF, GREGORY ALAN; CAPARROS-WANDERLEY, WILSON
To: PEPTCELL LIMITED
Reel/Frame 038224/0310 →
Priority Claims (2)
GB 0602416.0 · Feb 7, 2006 · national
GB 0613977.8 · Jul 13, 2006 · national
Continuity (2)
Continuation 12278728
Related Publication 20130243804A1 · Sep 19, 2013