Porin B (PorB) as a therapeutic target for prevention and treatment of infection by
View Patent ↗The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising one or more PorB peptides (other than a full-length PorB polypeptide), which peptides contain at least one epitope that can elicit Chlamydia -neutralizing antibodies. The invention also features methods for induction of a protective immune response against infection by Chlamydia and Chlamydiophila.
1. A composition comprising:
an isolated C. pneumoniae PorB polypeptide up to 60 amino acids in length wherein the isolated polypeptide contains an amino acid sequence that is at least 67% identical to the amino acid sequence GMIEVQSNYGFVWDVSLKKV (SEQ ID NO: 15), wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and
a pharmaceutically acceptable carrier.
2. The composition of claim 1 , wherein the isolated polypeptide contains the amino acid sequence GMIEVQSNYGFVWDVSLKKV (SEQ ID NO: 15).
3. The composition of claim 1 , wherein the isolated polypeptide contains the amino acid sequence GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPIDYIIA (SEQ ID NO:9).
4. The composition of claim 1 , wherein the isolated polypeptide contains the amino acid sequence GLIEVQSDYGIVWGLSLQKV (SEQ ID NO:40).
5. The composition of claim 1 , wherein the isolated polypeptide comprises at least 20 amino acids.
6. A composition comprising:
an isolated polypeptide up to 60 amino acids in length, wherein the isolated polypeptide contains an amino acid sequence of SEQ ID NO: 15 GMIEVQSNYGFVWDVSLKKV (SEQ ID NO:15), or an amino acid sequence of SEQ ID NO: 15 comprising at least one conservative amino acid substitution, wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and
a pharmaceutically acceptable carrier.
7. The composition of claim 6 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence different from the amino acid sequence of SEQ ID NO: 15 or SEQ ID NO: 15 comprising at least one conservative amino acid substitution.
8. The composition of claim 6 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:7 (ND1), SEQ ID NO:8 (ND2), and SEQ ID NO:10 (ND4).
9. The composition of claim 6 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (B1-2), SEQ ID NO:14 (B2-4), SEQ ID NO:16 (B3-3), SEQ ID NO:17 (B3-4), SEQ ID NO:18 (B4-4), and SEQ ID NO:19 (B5-1).
10. The composition of claim 6 , wherein the isolated polypeptide is a C. trachomatis PorB polypeptide.
11. The composition of claim 6 , wherein the isolated polypeptide is a polypeptide of amino acid sequence GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPIDYIIA (SEQ D NO: 9).
12. A composition comprising:
an isolated polypeptide up to 60 amino acids in length, wherein the isolated polypeptide contains an amino acid sequence of FVGVGADYRHASCPIDYIIA (SEQ ID NO: 17), or an amino acid sequence of SEQ ID NO: 17 comprising at least one conservative amino acid substitution, wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and
a pharmaceutically acceptable carrier.
13. The composition of claim 12 , wherein the isolated polypeptide contains the amino acid sequence of SEQ ID NO: 17, and wherein the isolated polypeptide is a fusion polypeptide comprising a non-PorB amino acid sequence and the amino acid sequence of SEQ ID NO:17.
14. The composition of claim 12 , wherein the isolated polypeptide contains the amino acid sequence of SEQ ID NO: 17 comprising at least one conservative amino acid substitution.
15. The composition of claim 14 , wherein the isolated polypeptide is a fusion polypeptide comprising a non-PorB amino acid sequence and the amino acid sequence of SEQ ID NO:17 comprising at least one conservative amino acid substitution.
16. The composition of claim 12 , wherein the isolated polypeptide is a polypeptide of amino acid sequence GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPIDYIIA (SEQ ID NO: 9).
17. The composition of claim 12 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence different from the amino acid sequence of SEQ ID NO: 17 or SEQ ID NO: 17 comprising at least one conservative amino acid substitution.
18. The composition of claim 12 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:7 (ND1), SEQ ID NO:8 (ND2), and SEQ ID NO:10 (ND4).
19. The composition of claim 12 , wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (B1-2), SEQ ID NO:14 (B2-4), SEQ ID NO:15 (B3-2), SEQ ID NO:16 (B3-3), SEQ ID NO:18 (B4-4), and SEQ ID NO:19 (B5-1).
20. The composition of claim 12 , wherein the isolated polypeptide is a C. trachomatis PorB polypeptide.