IP Library Granted Patent US 10,100,098
Granted Patent B2
US 10,100,098 · App. 15/007,949 · Granted Oct 16, 2018

Insulin production methods and proinsulin constructs

Inventors: Ronald E. Zimmerman (Greenwood, IN); David John Stokell (Indianapolis, IN); Michael Patrick Akers (Indianapolis, IN)
Assignee: Stelis Biopharma Private Limited
C07K14/62A61K38/28C12P21/02
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,100,098
App. No.
15/007,949
Granted
Oct 16, 2018
Kind
B2
Abstract

Novel proinsulins and glargine, aspart and Lis-Pro proinsulin analogs having specific amino acid and/or nucleic acid modifications suitable for improved methods of insulin production, as well as novel and highly efficient processes for preparing the same. The novel proinsulins and proinsulin analogs may be converted into human insulin and insulin analogs, respectively, that are useful in therapeutic preparations.

Claims (23)

1. A composition comprising a modified proinsulin sequence having the formula R 1 -(B 1 -B 29 )-B 30 -R 2 -R 3 -X-R 4 -R 5 -(A 1 -A 20 )-A 21 -R 6 , wherein:

R 1 is a tag sequence comprising one or more amino acids or R 1 is absent with an Arg or Lys present prior to the start of the B chain;

(B 1 -B 29 ) comprises residues 1-29 of a native human insulin B chain;

B 30 is Gly, Ala, Ser, Thr, Val, Leu, Ile, Asn, Gln, Cys, Met, Tyr, Phe, Pro, or Trp;

R 2 , R 3 and R 5 are Arg;

X is a sequence that comprises one or more amino acids or is absent, provided that X does not comprise a C-terminal Gly, Lys, or Arg when R 4 is absent;

R 4 is any amino acid other than Gly, Lys or Arg or is absent;

(A 1 -A 20 ) comprises residues 1-20 of a native human insulin A chain;

A 21 is Gly, Ala, Val, Leu, Ile, Pro, Phe, Trp, Met, Ser, Thr, Tyr, Asp, or Glu; and

R 6 is a tag sequence containing one or more amino acids or R 6 is absent, wherein the modified proinsulin sequence is MRFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPL ALEGSLQARGIVEQCCTSICSLYQLENYCGRHHHHHH (SEQ ID NO: 21).

2. A composition comprising a modified proinsulin sequence having the formula R 1 -(B 1 -B 29 )-B 30 -R 2 -R 3 -X-R 4 -R 5 -(A 1 -A 20 )-A 21 -R 6 , wherein:

R 1 is a tag sequence comprising one or more amino acids or R 1 is absent with an Arg or Lys present prior to the start of the B chain;

(B 1 -B 29 ) comprises residues 1-29 of a native human insulin B chain;

B 30 is Gly, Ala, Ser, Thr, Val, Leu, Ile, Asn, Gln, Cys, Met, Tyr, Phe, Pro, or Trp;

R 2 , R 3 and R 5 are Arg;

X is a sequence that comprises one or more amino acids or is absent, provided that X does not comprise a C-terminal Gly, Lys, or Arg when R 4 is absent;

R 4 is any amino acid other than Gly, Lys or Arg or is absent;

(A 1 -A 20 ) comprises residues 1-20 of a native human insulin A chain;

A 21 is Gly, Ala, Val, Leu, Ile, Pro, Phe, Trp, Met, Ser, Thr, Tyr, Asp, or Glu; and

R 6 is a tag sequence containing one or more amino acids or R 6 is absent, wherein the modified proinsulin sequence is

(SEQ ID NO: 22)

MRFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGP

GAGSLQPLALEGSLQARGIVEQCCTSICSLYQLENYCGKHHHHHH.

Continuity (18)
Continuation In Part 13750273 · Jan 25, 2013
Continuation 12658852 · Feb 16, 2010
Continuation 11725731 · Mar 20, 2007
Continuation 15007949 · Jan 27, 2016
Continuation In Part 13032806 · Feb 23, 2011
Continuation In Part 14725039 · May 29, 2015
Continuation 13740794 · Jan 14, 2013
Continuation 13032775 · Feb 23, 2011
Continuation 15007949 · Jan 27, 2016
Continuation In Part 14673146 · Mar 30, 2015
Continuation 13864955 · Apr 17, 2013
Continuation 13032814 · Feb 23, 2011
Continuation 15007949 · Jan 27, 2016
Continuation In Part 14704838 · May 5, 2015
Continuation 13750276 · Jan 25, 2013
Continuation 13032797 · Feb 23, 2011
Provisional Application 60874655 · Dec 13, 2006
Related Publication 20160289291A1 · Oct 6, 2016