Variants of human BMP7 protein
The present invention relates to novel variants of human BMP7 protein. The invention embodies vectors and host cells for the propagation of nucleic acid sequences encoding said proteins and the production thereof. Also disclosed are methods for the treatment of cancer, cartilage damage and degeneration, pain associated with osteoarthritis, or bone healing.
1. A protein comprising a polypeptide comprising the amino acid sequence of:
(SEQ ID NO: 3)
STGSKQRSQNRSKTPKNQEALRMANVAENSSSXaa 33 QRQXaa 37 CK
KHELYVSFRDLGWQDWIIAPXaa 60 GYAAXaa 65 YCEGECAFPLNSY
MNATNHAXaa 86 Xaa 87 QXaa 89 LXaa 91 HXaa 93 Xaa 94 NPETVP
KPCCAPTQLXaa 110 AISXaa 114 LYFDDXaa 120 SNVILKKXaa 128
RNMXaa 132 VXaa 134 ACGCH,
wherein:
Xaa 33 is D or M; Xaa 37 is A or P; Xaa 60 is E or Q; Xaa 65 is Y, S, or G; Xaa 86 is I, V, or L; Xaa 87 is V or L; Xaa 89 is T, S, or A; Xaa 91 is V or M; Xaa 93 is F or V; Xaa 94 is I, F, or M; Xaa 110 is G; Xaa 114 is V or M; Xaa 120 is S or Q; Xaa 128 is Y, F, or W; Xaa 132 is V, Q, or S; and Xaa 134 is R or K.
2. The protein of claim 1 , wherein Xaa 33 is D; Xaa 37 is A; Xaa 60 is E; Xaa 87 is V; Xaa 89 is T or A; Xaa 91 is V; Xaa 94 is I; Xaa 120 is S; Xaa 132 is V; and Xaa 134 is R.
3. The protein of claim 2 , wherein Xaa 65 is Y or G; and Xaa 86 is I or L.
4. The protein of claim 3 , wherein Xaa 65 is G; Xaa 86 is L; Xaa 89 is T; Xaa 93 is V; and Xaa 128 is F or W.
5. The protein of claim 4 , wherein Xaa 114 is V.
6. The protein of claim 5 , wherein the amino acid sequence of the polypeptide is SEQ ID NO: 8.
7. The protein of claim 1 , wherein the amino acid sequence of the polypeptide is selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 9, and SEQ ID NO: 10.
8. The protein of claim 1 , wherein the N-terminus of the polypeptide is covalently fused to the C-terminus of a human BMP7 pro-domain polypeptide comprising an amino acid sequence of SEQ ID NO: 18.
9. The protein of claim 1 , wherein the amino acid sequence of the polypeptide is selected from the group consisting of SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
10. A pharmaceutical composition comprising a protein of claim 1 , and one or more pharmaceutically acceptable excipients, diluents, or carriers.
11. The pharmaceutical composition of claim 10 , wherein the protein is a disulfide linked homodimer.
12. The pharmaceutical composition of claim 11 , wherein the composition further comprises a polypeptide having the amino acid sequence of SEQ ID NO: 18.
13. A method of treatment for cartilage damage and degeneration, pain associated with osteoarthritis, or bone healing comprising administering to a human patient in need thereof an effective amount of the protein of claim 1 .
14. A method of treatment for cartilage damage and degeneration, pain associated with osteoarthritis, or bone healing comprising administering to a human patient in need thereof an effective amount of the pharmaceutical composition of claim 10 .
15. A method of treatment for glioblastoma comprising administering to a human patient in need thereof an effective amount of the protein of claim 1 and an effective amount of all-trans retinoic acid (ATRA).
16. A method of treatment for glioblastoma comprising administering to a human patient in need thereof an effective amount of the pharmaceutical composition of claim 10 and an effective amount of all-trans retinoic acid (ATRA).