MeCP2 EXPRESSION CASSETTES
MECP2 EXPRESSION CASSETTES. The present invention provides nucleic acid molecules comprising a MeCP2 expression cassette, the expression cassette comprising, in operable linkage from 5′ to 3′: a 5′ transcriptional control region comprising a promoter capable of driving transcription in neural cells; an open reading frame encoding a MeCP2 protein; translation control signals; a 3′ untranslated region (3′UTR) comprising one or more of: (i) a binding site for mir-22; (ii) a binding site for mir-19; (iii) a binding site for miR-132; (iv) a binding site for miR124; and (v) an AU-rich element; and transcriptional termination signals; wherein the MeCP2 expression cassette is not more than about 5 kb in length. The invention further provides viral vectors, especially vectors derived from adeno-associated virus (AAV), for use in therapeutic delivery of such expression cassettes. The nucleic acid molecules and viral vectors disclosed herein provide novel tools for expressing MeCP2 and are of particular value in the treatment of disorders associated with reduced MeCP2 activity, including Rett syndrome.
1 .- 27 . (canceled)
28 . A method of treating Rett syndrome in a subject in need thereof, the method comprising administering to the subject an AAV vector comprising a MeCP2 expression cassette, the expression cassette comprising, in operable linkage from 5′ to 3′:
(a) a 5′ transcriptional control region comprising a promoter capable of driving transcription in neural cells, wherein the promoter is a MeCP2 promoter comprising a MeCP2 silencer element and a CNS regulatory element;
(b) a Kozak sequence;
(c) an open reading frame encoding a MeCP2 protein;
(d) a 3′ untranslated region (3′UTR) comprising a MeCP2 polyadenylation signal a binding site for miR-22, a binding site for miR-19, a binding site for miR-132, a binding site for miR-124, and one or more AU-rich element of the sequence AUUUA; and
(e) transcriptional termination signals; and
wherein the MeCP2 expression cassette is not more than about 5 kb in length.
29 . The method of claim 28 , wherein the encoded MeCP2 protein comprises the sequence:
(SEQ ID NO: 11)
PAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYD
VYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQK
PPGSSGSSGPKKKRKVPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKK
RKTRETV.
or is a variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto.
30 . The method of claim 28 , wherein the MeCP2 protein further comprises an N-terminal portion having a sequence
(SEQ ID NO: 12)
MAAAAAAAPSGGGGGGEEERLEEK.
31 . The method of claim 28 , wherein the AAV vector is a self-complementary AAV vector.
32 . The method of claim 28 , wherein the AAV vector is an AAV9 vector.
33 . The method of claim 28 , wherein the AAV vector is administered intrathecally.
34 . A method of enhancing expression of MeCP2 protein in a target cell comprising introducing into the target cell an AAV vector comprising a MeCP2 expression cassette, the expression cassette comprising, in operable linkage from 5′ to 3′:
(a) a 5′ transcriptional control region comprising a promoter capable of driving transcription in neural cells, wherein the promoter is a MeCP2 promoter comprising a MeCP2 silencer element and a CNS regulatory element;
(b) a Kozak sequence;
(c) an open reading frame encoding a MeCP2 protein;
(d) a 3′ untranslated region (3′UTR) comprising a MeCP2 polyadenylation signal a binding site for miR-22, a binding site for miR-19, a binding site for miR-132, a binding site for miR-124, and one or more AU-rich element of the sequence AUUUA; and
(e) transcriptional termination signals; and
wherein the MeCP2 expression cassette is not more than about 5 kb in length.
35 . The method of claim 34 , wherein the encoded MeCP2 protein comprises the sequence:
(SEQ ID NO: 11)
PAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYD
VYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQK
PPGSSGSSGPKKKRKVPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKK
RKTRETV.
or is a variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto.
36 . The method of claim 34 , wherein the MeCP2 protein further comprises an N-terminal portion having a sequence
SEQ ID NO: 12)
MAAAAAAAPSGGGGGGEEERLEEK
37 . The method of claim 34 , wherein the AAV vector is a self-complementary AAV vector.
38 . The method of claim 34 , wherein the AAV vector is an AAV9 vector.
39 . A method comprising:
testing a subject for the presence of one or more mutations in the MeCP2 gene indicative of the presence of, or a predisposition to, Rett syndrome; and,
if the subject has one or more mutations in the MeCP2 gene indicative of the presence of, or a predisposition to, Rett syndrome, administering to the subject an AAV vector comprising a MeCP2 expression cassette, the expression cassette comprising, in operable linkage from 5′ to 3′:
(a) a 5′ transcriptional control region comprising a promoter capable of driving transcription in neural cells, wherein the promoter is a MeCP2 promoter comprising a MeCP2 silencer element and a CNS regulatory element;
(b) a Kozak sequence;
(c) an open reading frame encoding a MeCP2 protein;
(d) a 3′ untranslated region (3′UTR) comprising a MeCP2 polyadenylation signal a binding site for miR-22, a binding site for miR-19, a binding site for miR-132, a binding site for miR-124, and one or more AU-rich element of the sequence AUUUA; and
(e) transcriptional termination signals; and
wherein the MeCP2 expression cassette is not more than about 5 kb in length.
40 . The method of claim 39 , wherein the encoded MeCP2 protein comprises the sequence:
(SEQ ID NO: 11)
PAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYD
VYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQK
PPGSSGSSGPKKKRKVPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKK
RKTRETV.
or is a variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto.
41 . The method of claim 39 , wherein the MeCP2 protein further comprises an N-terminal portion having a sequence
(SEQ ID NO: 12)
MAAAAAAAPSGGGGGGEEERLEEK.
42 . The method of claim 39 , wherein the AAV vector is a self-complementary AAV vector.
43 . The method of claim 39 , wherein the AAV vector is an AAV9 vector.
44 . The method of claim 39 , wherein the AAV vector is administered intrathecally.
45 . The method of claim 39 , wherein the one or more mutations in the MeCP2 gene indicative of the presence of, or a predisposition to, Rett syndrome is a loss of function mutation.