Metal-binding therapeutic peptides
The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes.
1. A polypeptide comprising the amino acid sequence ETFSDVWKLLKKGFYKKKQCRPSKGRKRGFCWAALDWSWLQT (SEQ ID NO: 220).
2. A composition comprising the polypeptide of claim 1 and a pharmaceutical excipient.
3. A nucleic acid encoding the polypeptide of claim 1 .
4. A vector comprising the nucleic acid of claim 3 .
5. A polypeptide comprising the amino acid sequence ETFSDIWKILLKKGFYKKKQCRPSKGRKRGFCWAALDWSWLQT (SEQ ID NO: 221).
6. A composition comprising the polypeptide of claim 5 and a pharmaceutical excipient.
7. A nucleic acid encoding the polypeptide of claim 5 .
8. A vector comprising the nucleic acid of claim 7 .
9. A polypeptide comprising the amino acid sequence ETFSDVWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYAWVQKRK (SEQ ID NO: 224).
10. A composition comprising the polypeptide of claim 9 and a pharmaceutical excipient.
11. A nucleic acid encoding the polypeptide of claim 9 .
12. A vector comprising the nucleic acid of claim 11 .
13. A polypeptide comprising the amino acid sequence ETFSDIWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYAWVQKRK (SEQ ID NO: 225).
14. A composition comprising the polypeptide of claim 13 and a pharmaceutical excipient.
15. A nucleic acid encoding the polypeptide of claim 13 .
16. A vector comprising the nucleic acid of claim 15 .
17. A polypeptide comprising the amino acid sequence HESRGVTEDYLRLETLVQKVVGFYKKKQCRPSKGRKRG FCW (SEQ ID NO: 265).
18. A composition comprising the polypeptide of claim 17 and a pharmaceutical excipient.
19. A nucleic acid encoding the polypeptide of claim 17 .
20. A vector comprising the nucleic acid of claim 19 .
21. A polypeptide comprising the amino acid sequence GVTEDYLRLETLVQKVVSPYLG FYKKKQCRPSKG RKRGFCW (SEQ ID NO: 266).
22. A composition comprising the polypeptide of claim 21 and a pharmaceutical excipient.
23. A nucleic acid encoding the polypeptide of claim 21 .
24. A vector comprising the nucleic acid of claim 23 .
25. A polypeptide comprising the amino acid sequence LRLETLVQKVVSPYLGTYG LHG FYKKKQCRPSKG RKRGFCW (SEQ ID NO: 267).
26. A composition comprising the polypeptide of claim 25 and a pharmaceutical excipient.
27. A nucleic acid encoding the polypeptide of claim 25 .
28. A vector comprising the nucleic acid of claim 27 .
29. A polypeptide comprising the amino acid sequence RGVTEDYLRLETLVQKVVSKG FYKKKQCRPSKG RKRGFCW (SEQ ID NO: 271).
30. A composition comprising the polypeptide of claim 29 and a pharmaceutical excipient.
31. A nucleic acid encoding the polypeptide of claim 29 .
32. A vector comprising the nucleic acid of claim 31 .