Antibody-light fusion products for cancer therapeutics
Antibody-LIGHT fusion products or conjugates stimulate immunity against tumors and eradicate metastases. Tumor-specific antibodies coupled with LIGHT effectively target metastatic tumors and reduces cancer metastases.
1. A composition comprising a tumor specific antibody linked to a fragment of a human LIGHT protein, wherein the LIGHT fragment is resistant to protease digestion and stimulates cytotoxic T lymphocytes against tumor cells.
2. The composition of claim 1 , wherein the antibody and the fragment of the LIGHT protein are a fusion protein.
3. The composition of claim 1 , wherein the fragment of the LIGHT protein is chemically conjugated to the antibody.
4. The composition of claim 1 , wherein the antibody is a humanized monoclonal antibody.
5. The composition of claim 1 , wherein the antibody is a chimeric antibody.
6. The composition of claim 1 , wherein the antibody is a heterominibody.
7. The composition of claim 1 , wherein the antibody is a single chain antibody.
8. The composition of claim 1 , wherein the antibody is an antibody fragment that binds a tumor antigen.
9. The composition of claim 1 , wherein the fragment of LIGHT protein comprises a section of an extracellular domain of the LIGHT protein.
10. The composition of claim 1 , wherein the fragment comprises about 100-150 amino acids of LIGHT.
11. The composition of claim 1 , wherein the fragment comprises the amino acid sequence from about position 85 to about position 240 of human LIGHT protein.
12. The composition of claim 1 , wherein the fragment of LIGHT comprises a mutation in the protease recognition sequence EQLI, thereby inactivating the protease recognition sequence.
13. The composition of claim 12 , wherein the mutation is a deletion mutation.
14. The composition of claim 9 , wherein the extracellular domain comprises the amino acid sequence
(SEQ ID NO: 2)
QLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTG
SGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCP
LGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFL
GGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV.
15. A method of reducing the growth of primary tumor or cancer metastasis, the method comprising:
(a) administering the composition of claim 1 ; and
(b) reducing the growth of primary tumor or cancer metastasis by stimulating activation of tumor-specific T-cells against the tumor.
16. The method of claim 15 , wherein the antibody recognizes a surface tumor antigen.
17. The method of claim 15 , wherein the antibody binds a tumor antigen selected from the group consisting of HER2, HER4, HER8, EGFR, and STEAP.
18. The method of claim 15 , wherein the antibody is conjugated to the LIGHT fragment chemically or recombinantly fused to the LIGHT fragment.
19. The method of claim 15 , wherein the LIGHT fragment comprises an extracellular domain of LIGHT comprising amino acids 85-240 of LIGHT protein.
20. The method of claim 15 , wherein the composition is administered intravenously.
21. The method of claim 15 , wherein the cancer metastasis is reduced by stimulating production of at least one of chemokines, adhesion molecules, and costimulatory molecules for priming naive T-cells.
22. The method of claim 15 , wherein the cancer is selected from the group consisting of breast cancer, lung cancer, prostrate cancer, colon cancer, renal cancer, liver cancer, leukemia, and skin cancer.
23. The method of claim 15 further comprising administering a chemotherapeutic agent or radiotherapy.