IP Library › Granted Patent US 8,273,352
Granted Patent B2
US 8,273,352 · App. 12/430,479 · Granted Sep 25, 2012

Humanized anti-factor D antibodies and uses thereof

Assignee: Genentech, Inc.
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 8,273,352
App. No.
12/430,479
Granted
Sep 25, 2012
Kind
B2
Abstract

The invention relates to anti-Factor D antibodies, their nucleic acid and amino acid sequences, the cells and vectors that harbor these antibodies and their production and their use in the preparation of compositions and medicaments for treatment of diseases and disorders associated with excessive or uncontrolled complement activation. These antibodies are useful for diagnostics, prophylaxis and treatment of disease.

Claims (60)

1. An anti-Factor D antibody or an antigen-binding fragment thereof comprising:

(a) a light chain variable domain comprising:

(1) light chain HVR-1 (HVR-L1) comprising the sequence ITSTDIDDDMN (SEQ ID NO: 30) or a sequence that differs from SEQ ID NO: 30 by one or more amino acid substitutions, wherein said one or more substitutions are substitution of the amino acid residue at position 10 of SEQ ID NO: 30 to L or I and/or substitution of the amino acid at position 11 of SEQ ID NO: 30 to A or Q,

(2) light chain HVR-2 (HVR-L2) comprising the sequence GGNTLRP (SEQ ID NO: 35) or a sequence that differs from SEQ ID NO: 35 by one amino acid substitution, wherein said one substitution is substitution of the amino acid residue at position 3 of SEQ ID NO: 35 to S or A, and,

(3) light chain HVR-3 (HVR-L3) comprising the sequence LQSDSLPYT (SEQ ID NO: 38); and

(b) a heavy chain variable domain comprising:

(1) heavy chain HVR-1 (HVR-H1) comprising the sequence GYTFTNYGMN (SEQ ID NO: 39),

(2) heavy chain HVR-2 (HVR-H2) comprising the sequence WINTYTGETTYADDFKG (SEQ ID NO: 40), and

(3) heavy chain HVR-3 (HVR-H3) comprising the sequence EGGVNN (SEQ ID NO: 41) or a sequence that differs from SEQ ID NO: 41 by one or more amino acid substitutions, wherein said one or more substitutions are substitution of the amino acid residue at position 5 of SEQ ID NO: 41 with A or Q and/or substitution of the amino acid residue at position 6 of SEQ ID NO: 41 with A or Q,

wherein said antibody or antigen-binding fragment thereof comprises at least one of the substitutions set forth in (a)(1), (a)(2), or (b)(3) above and/or the heavy chain variable domain comprises an E at position 1.

2. The anti-Factor D antibody or antigen-binding fragment of claim 1 , wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises an E at position 1 of the heavy chain variable domain.

3. The anti-Factor D antibody or antigen-binding fragment of claim 2 , wherein the light chain variable domain comprises the amino acid sequence of DIQVTQSPSSLSASVGDRVTITCITSTDIDDDX 4 X 5 WYQQKPGKVPKLLISGGX 6 TLRPGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKX 7 EIK (SEQ ID NO: 73), wherein X 4 is M, L or I; X 5 is N, A or Q; X 6 is N, S or A; and X 7 is L or V.

4. The anti-Factor D antibody or antigen-binding fragment of claim 3 , wherein X 7 is V.

5. The anti-Factor D antibody or antigen-binding fragment of claim 1 , wherein

(a) the heavy chain variable domain comprises:

i. an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39;

ii. an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40;

iii. an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44 or SEQ ID NO: 45; and

(b) the light chain variable domain comprises:

iv. an HVR-L1 comprising the amino acid sequence selected from SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34;

v. an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 35, SEQ ID NO: 36 or SEQ ID NO: 37; and

vi. an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 38.

6. The anti-Factor D antibody or antigen-binding fragment of claim 5 , wherein the HVR-H3 comprises the amino acid sequence of SEQ ID NO: 41.

7. The anti-Factor D antibody or antigen-binding fragment of claim 5 , wherein the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30.

8. The anti-Factor D antibody or antigen-binding fragment of claim 5 , wherein the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35.

9. The anti-Factor D antibody or antigen-binding fragment of claim 5 , wherein the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30, the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35, and the HVR-L3 comprises the amino acid sequence of SEQ ID NO: 38.

10. The anti-Factor D antibody or antigen-binding fragment of claim 5 , wherein the HVR-H1 comprises the amino acid sequence of SEQ ID NO: 39, the HVR-H2 comprises the amino acid sequence of SEQ ID NO: 40, the HVR-H3 comprises the amino acid sequence of SEQ ID NO: 41, the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30, the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35, and the HVR-L3 comprises the amino acid sequence of SEQ ID NO: 38.

11. The anti-Factor D antibody or antigen-binding fragment of claim 10 , wherein the light chain variable domain comprises the amino acid sequence of SEQ ID NO: 1, and wherein the amino acid residue at position 104 of SEQ ID NO: 1 is substituted with V.

12. The anti-Factor D antibody or antigen-binding fragment of claim 11 , wherein the amino acid residue at position 1 of the heavy chain variable domain is an E.

13. The anti-Factor D antibody or antigen-binding fragment of claim 1 , wherein the heavy chain variable domain comprises the sequence of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28 or SEQ ID NO: 29.

14. The anti-Factor D antibody or antigen-binding fragment of claim 1 , wherein the light chain variable domain comprises the sequence of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, or SEQ ID NO: 14.

15. An anti-Factor D antibody or antigen-binding fragment thereof, comprising a polypeptide comprising the following amino acid sequence: X 1 VQLVQSGPELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGWINTYTG ETTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCEREGGVX 2 X 3 WGQGTLVTVS S (SEQ ID NO: 74), wherein X 1 is E; X 2 is N, A or Q; and X 3 is N, A or Q.

16. The anti-Factor D antibody or antigen-binding fragment of claim 15 , wherein the anti-Factor D antibody or antigen-binding fragment thereof further comprises a polypeptide comprising the following amino acid sequence: DIQVTQSPSSLSASVGDRVTITCITSTDIDDDX 4 X 5 WYQQKPGKVPKLLISGGX 6 TLRPGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKX 7 EIK (SEQ ID NO:73), wherein X 4 is M, L or I; X 5 is N, A or Q; X 6 is N, S or A; and X 7 is L or V.

17. An anti-Factor D antibody or an antigen-binding fragment thereof, comprising the heavy chain variable domain sequence of SEQ ID NO: 19.

18. The anti-Factor D antibody or antigen-binding fragment of claim 17 , wherein the anti-Factor D antibody or antibody fragment thereof further comprises the light chain variable domain sequence of SEQ ID NO: 7.

19. An anti-Factor D antibody or an antigen-binding fragment thereof, comprising the heavy chain sequence of SEQ ID NO: 63.

20. The anti-Factor D antibody or antigen-binding fragment of claim 19 , wherein the anti-Factor D antibody further comprises the light chain sequence of SEQ ID NO: 61.

21. An anti-Factor D antibody or an antigen-binding fragment thereof, comprising:

(a) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residue at position 104 of SEQ ID NO: 1 is substituted with V; and

(b) a heavy chain variable domain comprising an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39, an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40, and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41,

wherein the amino acid residue at position 1 of the heavy chain variable domain is an E.

22. An anti-Factor D antibody or an antigen-binding fragment thereof made by the process of:

(a) culturing a cell expressing an anti-Factor D antibody or an antigen-binding fragment thereof comprising the heavy chain variable domain sequence of SEQ ID NO: 19 and the light chain variable domain sequence of SEQ ID NO: 7; and

(b) isolating the antibody or antigen-binding fragment from said cultured cell.

23. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 and 21 , wherein the anti-Factor D antibody is a monoclonal antibody.

24. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 and 21 , wherein the antigen-binding fragment is a Fab, Fab′-SH, Fv, scFv, or (Fab′) 2 fragment.

25. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 and 21 , wherein the anti-Factor D antibody is a humanized antibody.

26. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 , 19 , 20 and 21 , wherein the Factor D is mammalian Factor D.

27. The anti-Factor D antibody or antigen-binding fragment of claim 26 , wherein the Factor D is human Factor D.

28. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 , 19 , 20 and 21 , which is produced in bacteria.

29. The anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 , 19 , 20 and 21 , which is produced in CHO cells.

30. A pharmaceutical formulation comprising the anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 , 19 , 20 and 21 , and a pharmaceutically acceptable diluent, carrier or excipient.

31. An article of manufacture comprising:

(a) the pharmaceutical formulation of claim 30 ;

(b) a container; and

(c) a package insert or label indicating that the pharmaceutical formulation-can be used to treat a complement-associated disorder.

32. A kit comprising the anti-Factor D antibody or antigen-binding fragment of any one of claims 1 , 15 , 16 , 17 , 18 , 19 , 20 and 21 , and instructions for administering said antibody to treat a complement-associated disorder.

33. The kit of claim 32 , wherein the complement-associated disorder is an ocular disease.

34. The kit of claim 33 , wherein the ocular disease is selected from the group consisting of age-related macular degeneration (AMD), diabetic retinopathy, choroidal neovascularization (CNV), uveitis, diabetic macular edema, pathological myopia, von Hippel-Lindau disease, histoplasmosis of the eye, Central Retinal Vein Occlusion (CRVO), corneal neovascularization, and retinal neovascularization.

35. The kit of claim 34 , wherein the age-related macular degeneration is intermediate dry AMD or geographic atrophy.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jun 17, 2009
From: HUANG, ARTHUR; KELLEY, ROBERT; LOWMAN, HENRY; CAMPAGNE, MENNO VAN LOOKEREN; WINTER, CHARLES
To: GENENTECH, INC.
Reel/Frame 022839/0040 →
Continuity (3)
Provisional Application 61048689 · Apr 29, 2008
Provisional Application 61048431 · Apr 28, 2008
Related Publication 20090269338A1 · Oct 29, 2009