Methods for assaying percentage of glycated hemoglobin
The invention provides enzymatic methods for direct determination of percentage of glycated hemoglobin in blood samples without the need of a separated measurement of total hemoglobin content in blood samples. The methods utilizes one or two different types of oxidizing agents which selectively oxidize low-molecular weight reducing substances and high-molecular weight (mainly hemoglobin) reducing substances in blood samples, coupled with enzymatic reactions catalyzed by proteases, fructosyl amino acid oxidase, and peroxidase. The invention provides kits for performing the methods of the invention.
1. A method for directly assaying percentage of glycated hemoglobin A1c in a blood sample without measuring the total hemoglobin in the blood sample in a separate process, said method comprising:
a) contacting protein fragments containing glycated peptides or glycated amino acids with a fructosyl amino acid oxidase to generate hydrogen peroxide (H 2 O 2 ), wherein the protein fragments are generated by contacting the blood sample with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes low molecular weight reducing substances; 3) a second oxidizing agent which selectively oxidizes high molecular weight reducing substances, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids;
b) contacting H 2 O 2 generated in step a) with a color forming substance in the presence of a peroxidase to generate a measurable signal; and
c) determining percentage of glycated hemoglobin A1c in the sample by correlating the measured value from the generated signal in step b) to a percentage of glycated hemoglobin A1c in a calibration curve without measuring the total hemoglobin in the blood sample separately.
2. The method of claim 1 , wherein the first oxidizing agent comprises Dess-Martin periodinane and/or N-ethylmaleimide, and wherein the second oxidizing agent comprises a tetrazolium salt.
3. The method of claim 2 , wherein tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.
4. The method of claim 2 , wherein the protease generates a glycated peptide from about 2 to about 30 amino acid residues.
5. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent or the second oxidizing agent.
6. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent and the second oxidizing agent.
7. The method of claim 1 , wherein the lysing buffer contains the first oxidizing agent, the second oxidizing agent, and the protease.
8. The method of claim 1 , wherein the lysing buffer contains the protease.
9. The method of claim 1 , wherein the first oxidizing agent and the second oxidizing agent are formulated in a single composition.
10. The method of claim 1 , wherein the first oxidizing agent and the second oxidizing agent are formulated in a separate composition.
11. The method of claim 1 , wherein the protease is formulated in a single composition with the first oxidizing agent or the second oxidizing agent.
12. The method of claim 1 , wherein the first oxidizing agent, the second oxidizing agent, and the protease are formulated in a single composition.
13. The method of claim 1 , wherein the fructosyl amino acid oxidase, the peroxidase, and the color forming substance are formulated in a single composition.
14. The method of claim 1 , wherein the color forming substance is N-Carboxymethylaminocarbonyl)-4,4′-bis(dimethylamino)-diphenylamine sodium salt (DA-64), N,N,N′N′,N″,N″-Hexa(3-sulfopropyl)-4,4′,4″,-triamino-triphenylmethane hexasodium salt (TPM-PS), or 10-(carboxymethylaminocarbonyl)-3,7-bis(dimethylamino)-phenothiazine sodium salt (DA-67).
15. The method of claim 1 , wherein the blood sample is whole blood.
16. The method of claim 1 , wherein the protease is an endo-type protease or an exo-type protease.
17. The method of claim 1 , wherein the protease is selected from the group consisting of proteinase K, pronase E, ananine, thermolysin, subtilisin and cow pancreas proteases.
18. The method of claim 1 , wherein the protease is a neutral protease of Aspergillus or Bacillus origin.
19. The method of claim 1 , wherein the protease generates glycated glycine, glycated valine or glycated lysine residue or a glycated peptide comprising glycated glycine, glycated valine or glycated lysine residue.
20. The method of claim 1 , wherein the peroxidase is horseradish peroxidase.
21. The method of claim 1 , wherein the protein fragments containing the glycated peptide or glycated amino acid are contacted with the fructosyl amino acid oxidase and the peroxidase sequentially or simultaneously.
22. The method of claim 1 , wherein the fructosyl amino acid oxidase comprises the amino acid sequence set forth in SEQ ID NO:1
(MGGSGDDDDLALAVTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLD
PYPVPSAISAGNDVNKVISSGQYSNNKDEIEVNEILAEEAFNGWKNDPL
FKPYYHDTGLLMSACSQEGLDRLGVRVRPGEDPNLVELTRPEQFRKLAP
EGVLQGDFPGWKGYFARSGAGWAHARNALVAAAREAQRMGVKFVTGTPQ
GRVVTLIFENNDVKGAVTGDGKIWRAERTFLCAGASAGQFLDFKNQLRP
TAWTLVHIALKPEERALYKNIPVIFNIERGFFFEPDEERGEIKICDEHP
GYTNMVQSADGTMMSIPFEKTQIPKEAETRVRALLKETMPQLADRPFSF
ARICWCADTANREFLIDRHPQYHSLVLGCGASGRGFKYLPSIGNLIVDA
MEGKVPQKIHELIKWNPDIAANRNWRDTLGRFGGPNRVMDFHDVKEWTN
VQYRDISKLKGELEGLPIPNPLLRTGHHHHHH).
23. The method of claim 1 , further comprising using the percentage of glycated hemoglobin A1c for prognosing or diagnosing a disease or disorder.
24. The method of claim 23 , wherein the disease or disorder is diabetes.
25. A kit for directly assaying percentage of glycated hemoglobin A1c in a blood sample without the need of a separate measurement of total hemoglobin content in blood samples, said kit comprising:
a) a lysing buffer which lyses blood cells to release hemoglobin;
b) a first oxidizing agent which selectively oxidizes low molecular weight reducing substances;
c) a second oxidizing agent which selectively oxidizes high molecular weight reducing substances;
d) a protease which hydrolyzes hemoglobin into protein fragments containing glycated peptides or glycated amino acids;
e) a fructosyl amino acid oxidase which reacts with glycated peptides and glycated amino acids to generate hydrogen peroxide (H 2 O 2 );
f) a peroxidase and a color forming substance;
g) calibrator(s) with known known percentage of glycated hemoglobin A1c for use in constructing a calibration curve; and
h) instructions to perform the method of claim 1 .
26. The kit of claim 25 , wherein the first oxidizing agent and the second oxidizing agent are contained in the lysing buffer.
27. The kit of claim 25 , wherein the first oxidizing agent and the second oxidizing agent are contained in the same buffer with the protease.
28. The kit of claim 25 , wherein the fructosyl amino acid oxidase, the peroxidase, and the color forming substance are formulated in a single composition.
29. The kit of claim 25 , wherein the wherein the fructosyl amino acid oxidase comprises the amino acid sequence set forth in SEQ ID NO:1
(MGGSGDDDDLALAVTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLD
PYPVPSAISAGNDVNKVISSGQYSNNKDEIEVNEILAEEAFNGWKNDPL
FKPYYHDTGLLMSACSQEGLDRLGVRVRPGEDPNLVELTRPEQFRKLAP
EGVLQGDFPGWKGYFARSGAGWAHARNALVAAAREAQRMGVKFVTGTPQ
GRVVTLIFENNDVKGAVTGDGKIWRAERTFLCAGASAGQFLDFKNQLRP
TAWTLVHIALKPEERALYKNIPVIFNIERGFFFEPDEERGEIKICDEHP
GYTNMVQSADGTMMSIPFEKTQIPKEAETRVRALLKETMPQLADRPFSF
ARICWCADTANREFLIDRHPQYHSLVLGCGASGRGFKYLPSIGNLIVDA
MEGKVPQKIHELIKWNPDIAANRNWRDTLGRFGGPNRVMDFHDVKEWTN
VQYRDISKLKGELEGLPIPNPLLRTGHHHHHH).
30. The kit of claim 25 , wherein the first oxidizing agent comprises Dess-Martin periodinane and/or N-ethylmaleimide, and wherein the second oxidizing agent comprises a tetrazolium salt.
31. The kit of claim 30 , wherein tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.
32. The kit of claim 25 , wherein the color forming substance is N-Carboxymethylaminocarbonyl)-4,4′-bis(dimethylamino)-diphenylamine sodium salt (DA-64), N,N,N′N′,N″,N″-Hexa(3-sulfopropyl)-4,4′,4″,-triamino-triphenylmethane hexasodium salt (TPM-PS), or 10-(carboxymethylaminocarbonyl)-3,7-bis(dimethylamino)-phenothiazine sodium salt (DA-67).