Fibroblast growth factor 21 variants having improved pharmacological potency and/or improved pharmaceutical stability
This present invention relates to pharmacologically potent and/or stable variants of human fibroblast growth factor 21 (FGF21), pharmaceutical compositions comprising FGF21 variants, and methods for treating type 2 diabetes, obesity, dyslipidemia, or metabolic syndrome, or any combination thereof, using such variants.
1. A variant of human fibroblast growth factor 21 (FGF21), wherein the amino acid sequence is
(SEQ ID NO: 1)
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPE
SLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLL
EDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPP
GILAPQPPDVGSSDPLRLVEPSQLLSPSFLG.
2. A pharmaceutical composition comprising the variant of claim 1 , and at least one pharmaceutically acceptable carrier, diluent, or excipient.
3. A method for treating type 2 diabetes, obesity, dyslipidemia, or metabolic syndrome, or any combination thereof, comprising administering the variant of claim 1 to a patient in need thereof.