Apolipoprotein AIV as an antidiabetic peptide
Methods for treating type two diabetes mellitus in a subject in need thereof and pharmaceutical compositions for the treatment of type two diabetes mellitus are disclosed. The methods include administering an effective amount of apolipoprotein A-IV to the subject. The pharmaceutical composition includes apolipoprotein A-IV formulated for administration to a subject for the treatment of type two diabetes mellitus. Also disclosed are methods for substantially restoring glucose tolerance in a subject in need thereof to a normal level and methods for lowering blood glucose levels in a subject in need thereof.
1. A method for treating type II diabetes mellitus in a subject in need thereof, the method comprising administering to the subject an effective amount of a polypeptide, wherein the amino acid sequence of the polypeptide is:
(SEQ ID NO. 3)
GEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGE
VNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHA
NEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMER
VLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT
VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELR
QRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGEN
FNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKE
SQDKTLSLPELEQQQEQQ Q EQQQEQVQMLAPLES.
2. The method of claim 1 , wherein the subject is a human.
3. The method according to claim 2 , wherein the polypeptide is glycosylated.
4. The method according to claim 2 , wherein the polypeptide is unglycosylated.
5. The method according to claim 4 , wherein the polypeptide is administered systemically.
6. The method according to claim 5 , wherein the systemic administration of the polypeptide is selected from the group consisting of oral, subcutaneous, intravenous, intramuscular, and intraperitoneal administration.
7. The method according to claim 6 , wherein the polypeptide is administered in a dose of about 1 to about 10 μg/g.
8. The method according to claim 6 , wherein the is administered in a dose of about 0.25 to about 2 μg/g.
9. The method according to claim 6 , wherein the polypeptide is administered in a dose of about 1 μg/g.
10. The method according to claim 6 , wherein the polypeptide is administered once daily.
11. The method according to claim 6 , wherein of the polypeptide is administered about 2 times per day.
12. A method of lowering blood glucose level in a subject in need thereof, the method comprising administering to the subject an effective amount of a polypeptide, wherein the amino acid sequence of the polypeptide is:
(SEQ ID NO. 3)
GEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGE
VNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHA
NEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMER
VLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT
VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELR
QRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGEN
FNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKE
SQDKTLSLPELEQQQEQQ Q EQQQEQVQMLAPLES.
13. The method of claim 12 , wherein the subject is a human.
14. The method according to claim 13 , wherein the polypeptide is glycosylated.
15. The method according to claim 13 , wherein the polypeptide is unglycosylated.
16. The method according to claim 15 , wherein the polypeptide is administered systemically.
17. The method according to claim 16 , wherein the systemic administration of the polypeptide is selected from the group consisting of oral, subcutaneous, intravenous, intramuscular, and intraperitoneal administration.
18. The method according to claim 17 , wherein the polypeptide is administered in a dose of about 1 to about 10 μg/g.
19. The method according to claim 17 , wherein the polypeptide is administered in a dose of about 0.25 to about 2 μg/g .
20. The method according to claim 17 , wherein the polypeptide is administered in a dose of about 1 μg/g.
21. The method according to claim 17 , wherein the polypeptide is administered once daily.
22. The method according to claim 17 , wherein the polypeptide is administered about 2 times per day.