Therapeutic dosing of a neuregulin or a subsequence thereof for treatment or prophylaxis of heart failure
The invention relates to treatment of heart failure in a mammal. Accordingly, the invention is directed to establishing a dosing regimen whereby the therapeutic benefits conferred by administration of a neuregulin such as glial growth factor 2 (GGF2) or a subsequence thereof are maintained and/or enhanced, while concomitantly minimizing any potential side effects.
1. A method for treating heart failure in a human, said method comprising:
administering a therapeutically effective amount of a peptide comprising an epidermal growth factor-like (EGF-like) domain of GGF2 to the human at an interval of at least 96 hours, wherein said therapeutically effective amount is effective to treat heart failure in said human.
2. The method of claim 1 , wherein said administering is performed every 96 hours.
3. The method of claim 1 , wherein said administration is performed on a regimen selected from the group consisting of every: four days, one week, 10 days, 14 days, one month, two months, three months or four months.
4. The method of claim 1 , wherein said peptide is recombinant human GGF2.
5. The method of claim 1 , wherein the peptide is:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYV
MASFYSTSTPFLSLPE. (SEQ ID NO: 4)