Anti-PD-L1 antibodies and uses thereof
The present application relates to anti-PD-L1 antibodies or antigen binding fragments thereof, nucleic acid encoding the same, therapeutic compositions thereof, and their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity, for the treatment of and cancer.
1. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising:
a light chain variable region; and
a heavy chain variable region comprising HVR-H1, HVR-H2, and HVR-H3 sequences, wherein:
(a) the HVR-H1 sequence is X 1 YX 2 MX 3 (SEQ ID NO:1);
(b) the HVR-H2 sequence is SIYPSGGX 4 TFYADX 5 VKG (SEQ ID NO:2); and
(c) the HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO:3);
and further wherein:
X 1 is K, R, T, Q, G, A, W, M, I or S;
X 2 is V, R, K, L, M or I;
X 3 is H, T, N, Q, A, V, Y, W, F or M;
X 4 is F or I; X 5 is S or T; and
X 6 is E or D.
2. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 1 , wherein:
(a) X 1 is M, I or S; X 2 is R, K, L, M or I; X 3 is F or M; X 4 is F or I; X 5 is S or T; and X 6 is E or D;
(b) X 1 is M, I or S; X 2 is L, M or I; X 3 is F or M; X 4 is I; X 5 is S or T; and X 6 is D; or
(c) X 1 is S; X 2 is I; X 3 is M; X 4 is I; X 5 is T; and X 6 is D.
3. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 1 , wherein the heavy chain variable region comprises heavy chain framework sequences HC-FR1, HC-FR2, HC-FR3 and HC-FR4 interposed between the HVRs, thus forming a sequence of the formula: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)-(HC-FR4).
4. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 3 , wherein the heavy chain framework sequences are derived from human consensus heavy chain framework sequences or from human germline heavy chain framework sequences.
5. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 3 , wherein one or more of the heavy chain framework sequences is selected from:
(a) HC-FR1 is
(SEQ ID NO: 4)
EVQLLESGGGLVQPGGSLRLSCAASGFTFS;
(b) HC-FR2 is
(SEQ ID NO: 5)
WVRQAPGKGLEWVS;
(c) HC-FR3 is
(SEQ ID NO: 6)
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR; or
(d) HC-FR4 is
(SEQ ID NO: 7)
WGQGTLVTVSS.
6. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 5 , further comprising a C H 1 domain or a C H 1, a C H 2 and a C H 3 domain.
7. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 1 , wherein the light chain variable region comprises HVR-L1, HVR-L2 and HVR-L3 sequences, wherein:
(a) the HVR-L1 sequence is TGTX 7 X 8 DVGX 9 YNYVS (SEQ ID NO: 8);
(b) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO: 9); and
(c) the HVR-L3 sequence is SSX 13 TX 14 X 15 X 16 X 17 RV (SEQ ID NO: 10);
and further wherein:
X 7 is N or S;
X 8 is T, R or S;
X 9 is A or G;
X 10 is E or D;
X 11 is I, N or S;
X 12 is D, H or N;
X 13 is F or Y;
X 14 is N or S;
X 15 is R, T or S;
X 16 is G or S; and
X 17 is I or T.
8. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 7 , wherein:
(a) X 7 is N or S; X 8 is T, R or S; X 9 is A or G; X 10 is E or D; X II is N or S; X 12 is NT; X 13 is F or Y; X 14 is S; X 15 is S; X 16 is G or S; and X 17 is T; or
(b) X 7 is S; X 8 is S; X 9 is G; X 10 is D; X 11 is S; X 12 is N; X 13 is Y; X 14 is S; X 15 is S; X 16 is S; and X 17 is T.
9. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 7 , wherein the light chain variable region comprises light chain framework sequences LC-FR1, LC-FR2, LC-FR3 and LC-FR4, interposed between the HVRs, thus forming a sequence of the formula: (LC-FR1)-(HVR-L1)-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
10. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 9 , wherein the light chain framework sequences are derived from human consensus light chain framework sequences or human germline light chain framework sequences.
11. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 9 , wherein one or more of the light chain framework sequences is selected from:
(a) LC-FR1 is
(SEQ ID NO: 11)
QSALTQPASVSGSPGQSITISC;
(b) LC-FR2 is
(SEQ ID NO: 12)
WYQQHPGKAPKLMIY;
(c) LC-FR3 is
(SEQ ID NO: 13)
GVSNRFSGSKSGNTASLTISGLQAEDEADYYC; or
(d) LC-FR4 is
(SEQ ID NO: 14)
FGTGTKVTVL.
12. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 11 , further comprising a C L domain.
13. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 7 further comprising a human or murine constant region.
14. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 13 , wherein the constant region is selected from the group consisting of IgG1, IgG2, IgG3 and IgG4.
15. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising a heavy chain variable region and a light chain variable region, wherein:
(a) the heavy chain variable region comprises an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO: 15), SIYPSGGITFYADTVKG (SEQ ID NO: 16), and IKLGTVTTVDY (SEQ ID NO: 17), respectively; and
(b) the light chain variable region comprises an HVR-L1, an HVR-L2, and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18), DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO: 20), respectively.
16. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 15 , wherein the heavy chain variable region or the light chain variable region sequence identity is at least 90%.
17. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 15 , wherein, as compared to the sequences of HVR-H1 (SEQ ID NO: 15), HVR-H2 (SEQ ID NO: 16), and HVR-H3 (SEQ ID NO: 17), at least those amino acids that remain unchanged are as follows:
(a) residues 2 and 4 of SEQ ID NO:15,
(b) residues 1-7, 9-13, and 15-17 of SEQ ID NO:16, and
(c) residues 1-9 and 11 of SEQ ID NO:17;
and further wherein, as compared to the sequences of HVR-L1 (SEQ ID NO: 18), HVR-L2 (SEQ ID NO: 19) and HVR-L3 (SEQ ID NO: 20), at least those amino acids that remain unchanged are as follows:
(a) residues 1-3, 6-8, and 10-14 of SEQ ID NO:18;
(b) residues 1 and 5-7 of SEQ ID NO:19; and
(c) residues 1-2 and 9-10 of SEQ ID NO:20.
18. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising a heavy chain variable region sequence and a light chain variable region sequence, wherein:
(a) the heavy chain variable region sequence has at least 85% sequence identity to the heavy chain variable region sequence:
(SEQ ID NO: 24)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGK
GLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSL
RAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS;
and
(b) the light chain variable region sequence has at least 85% sequence identity to the light chain variable region sequence:
(SEQ ID NO: 25)
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPG
KAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEA
DYYCSSYTSSSTRVFGTGTKVTVL.
19. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 18 , wherein the sequence identity of the heavy chain variable region or the light chain variable region is at least 90%.
20. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 18 , wherein:
(a) the heavy chain variable region comprises the sequence:
(SEQ ID NO: 24)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGK
GLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSL
RAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS;
and
(b) the light chain variable region comprises the sequence:
(SEQ ID NO: 25)
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHP
GKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAED
EADYYCSSYTSSSTRVFGTGTKVTVL.
21. The anti-PD-L1 antibody or antigen binding fragment of claim 20 , wherein the antibody further comprises a C H 1, a C H 2, a C H 3 and a C L domain.
22. The anti-PD-L1 antibody or antigen binding fragment of claim 7 , wherein the antibody binds to human, mouse or cynomolgus monkey PD-L1, or wherein the antibody is capable of blocking the interaction between human, mouse, or cynomolgus monkey PD-L1 and the respective human, mouse, or cynomolgus monkey PD-1 receptors.
23. The anti-PD-L1 antibody or antigen binding fragment of claim 7 , wherein the antibody binds to human PD-L1 with a K D of 5×10 −9 M or less.
24. An isolated anti-PD-L1 antibody or antigen binding fragment thereof wherein the antibody cross-competes for binding to PD-L1 with the anti-PD-L1 antibody or antigen binding fragment of claim 7 .
25. A composition comprising the anti-PD-L1 antibody or antigen binding fragment of claim 7 and at least one pharmaceutically acceptable carrier.
26. An isolated nucleic acid encoding the light chain or a heavy chain sequence of the anti-PD-L1 antibody or antigen binding fragment of claim 7 .
27. A vector comprising the nucleic acid of claim 26 .
28. A cultured host cell comprising the vector of claim 27 .
29. A process for making an anti-PD-L1 antibody or antigen binding fragment thereof comprising culturing the host cell of claim 28 under conditions suitable for the expression of the vector encoding the anti-PD-L1 antibody or antigen binding fragment, and recovering the antibody or fragment.
30. A kit of parts comprising the composition of claim 25 and at least one further therapeutic agent or vaccine.
31. A method of treating tumor immunity or cancer comprising administering to a subject in need thereof an effective amount of the composition of claim 25 .
32. An isolated anti PD-L1 antibody wherein the antibody comprises:
(a) a heavy chain variable region (VH) comprising an HVR-H1, HVR-H2 and HVR-H3 of SEQ ID NO: 32; and
(b) a light chain variable region (VL) comprising an HVR-L1, HVR-L2 and HVR-L3 of SEQ ID NO: 33.
33. The isolated anti PD-L1 antibody of claim 32 , wherein the HVR-H1 comprises the amino acid sequence of SEQ ID NO: 15, the HVR-H2 comprises the amino acid sequence of SEQ ID NO: 16, the HVR-H3 comprises the amino acid sequence of SEQ ID NO: 17, the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 18, the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 19, and the HVR-L3 comprises the amino acid sequence of SEQ ID NO: 20.
34. The isolated anti PD-L1 antibody of claim 32 , wherein the antibody comprises:
(a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 32, or the amino acid sequence of SEQ ID NO: 32 without the C-terminal lysine; and
(b) a light chain comprising the amino acid sequence of SEQ ID NO: 33.
35. The isolated anti PD-L1 antibody of claim 32 , wherein each HVR is defined in accordance with the Kabat definition, the Chothia definition, a combination of the Kabat definition and the Chothia definition, the AbM definition, or the contact definition of HVR.