IP Library Granted Patent US 10,232,020
Granted Patent B2
US 10,232,020 · App. 15/513,748 · Granted Mar 19, 2019

Incretin-insulin conjugates

Inventors: Richard D. Dimarchi (Carmel, IN); John P. Mayer (Indianapolis, IN); David L. Smiley (Bloomington, IN); Fa Liu (Zionsville, IN)
Assignee: Indiana University Research and Technology Corporation
A61K38/22A61K38/28A61K47/48061A61K47/48246A61K47/64C07K14/575C07K14/605C07K14/62A61K9/0019A61K9/0024A61K38/00A61K47/02C07K2/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,232,020
App. No.
15/513,748
Granted
Mar 19, 2019
Kind
B2
Abstract

Disclosed herein are insulin agonist peptides conjugated to incretins wherein the incretin-insulin conjugate has agonist activity at the insulin receptor and the corresponding incretin receptor, and stimulates weight loss in an individual administered the compound.

Claims (237)

1. An incretin-insulin conjugate comprising

an incretin peptide and

an insulin agonist peptide, wherein said conjugate has agonist activity at both the insulin receptor and an incretin receptor, and the incretin peptide is linked to the insulin agonist peptide via a linear chain spacer, wherein the incretin peptide is selected from the group consisting of:

(i) the amino acid sequence: X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z 1 (SEQ ID NO: 839) with 1 to 3 amino acid modifications thereto, wherein:

X1 is selected from the group consisting of: His, D-His, N-methyl-His, alpha-methyl-His, imidazole acetic acid, des-amino-His, hydroxyl-His, acetyl-His, homo-His, and alpha, alpha-dimethyl imidiazole acetic acid (DMIA);

X2 is selected from the group consisting of: Ser, D-Ser, Ala, D-Ala, Gly, N-methyl-Ser, Val, and alpha-aminoisobutyric acid (Aib);

Z 1 is selected from the group consisting of Asn-Thr-COOH, and Y-COOH, wherein Y is 1 to 2 amino acids, and further wherein:

(1) a lactam bridge connects the side chains of an amino acid at position i and an amino acid at position i+4, wherein i is 12, 16, 20 or 24, or

(2) one, two, or three of the amino acids at positions 16, 20, 21, and 24 of the incretin peptide is substituted with an α,α-disubstituted amino acid;

and said incretin peptide has glucagon agonist activity;

(ii) the amino acid sequence of X 1 X 2 X 3 GTFTSDX 10 SX 12 YLX 15 X 16 X 17 X 18 AX 20 X 21 FX 23 X 24 WLX 27 X 28 X 29 (SEQ ID NO: 1926), wherein:

X 1 is selected from the group consisting of His, D-His, des-amino-His, hydroxyl-His, acetyl-His, homo-His or alpha, alpha-dimethyl imidiazole acetic acid (DMIA), N-methyl His, alpha-methyl His, and imidazole acetic acid;

X 2 is selected from the group consisting of Ser, D-Ser, Ala, D-Ala, Val, Gly, N-methyl Ser, aminoisobutyric acid (Aib) and N-methyl Ala;

X 3 is selected from the group consisting of Gln, Glu, Orn and Nle;

X 10 is selected from the group consisting of Tyr, Val and Trp;

X 12 is selected from the group consisting of Ser, Lys and Arg;

X 15 is selected from the group consisting of Asp, Glu, cysteic acid, homoglutamic acid and homocysteic acid;

X 16 is selected from the group consisting of Ser, Gly, Glu, Gln, homoglutamic acid and homocysteic acid;

X 17 is selected from the group consisting of Arg, Gln, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;

X 18 is selected from the group consisting of Arg, Ala, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;

X 20 is selected from the group consisting of Gln, Lys, Arg, Orn and citrulline;

X 21 is selected from the group consisting of Gln, Glu, Asp, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;

X 23 is selected from the group consisting of Val and Ile;

X 24 is selected from the group consisting of Ala, Gln, Glu, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;

X 27 is selected from the group consisting of Met, Val, Leu and Nle;

X 28 is selected from the group consisting of Asn, Lys and Asp; and

X 29 is selected from the group consisting of Thr, Gly, Lys, Cys, Orn, homocysteine and acetyl phenylalanine; or an analog of SEQ ID NO: 1926, wherein said analog differs from SEQ ID NO: 1926 by 1, 2 or 3 amino acid modifications;

(iii) an incretin peptide of SEQ ID NO: 701 or an analog thereof, wherein said analog is modified to comprise:

(a) an amino acid modification at position 1 that confers gastric inhibitory polypeptide (GIP) agonist activity,

(b) (1) a lactam bridge between the side chains of amino acids at positions i and i+4 or between the side chains of amino acids at positions j and j+3, wherein i is 12, 13, 16, 17, 20 or 24, and wherein j is 17, or

(2) one, two, three, or all of the amino acids at positions 16, 20, 21, and 24 of the incretin peptide of SEQ ID NO: 701 is substituted with an α,α-disubstituted amino acid,

(c) amino acid modifications at one, two or all of positions 27, 28 and 29, and

(d) 1-6 further amino acid modifications,

wherein the EC50 of the analog for GIP receptor activation is about 10 nM or less;

(iv) the sequence of SEQ ID NO: 701 with

(a) an amino acid at position 10 which is acylated with a C4 to C30 fatty acid, and

(b) an Aib at position 16;

(v) an amino acid sequence that differs from SEQ ID NO: 701 by no more than ten amino acid modifications, comprising one or more amino acid substitutions with Aib at positions 16, 20, 21, and/or 24, and an amino acid modification at position 1 and/or 2 that provides reduced susceptibility to cleavage by dipeptidyl peptidase IV, wherein said incretin peptide exhibits at least 20% of the activity of native glucagon like peptide-1 (GLP-1) at the GLP-1 receptor;

(vi) any of the incretin peptides (i)-(v), further comprising the amino acid sequence of GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096) attached to the C-terminus of the incretin peptide, wherein X is any amino acid;

(vii) the amino acid sequence of SEQ ID NO: 701 with the following amino acid modifications: Tyr at position 1, an Aib at position 2, Lys at position 10, wherein the Lys is covalently bound to a C16 fatty acyl group via a γ-Glu-γ-Glu dipeptide spacer, Ile at position 12, Lys at position 16, Gln at position 17, Ala at position 18, Aib at position 20, Glu at position 21, Asn at position 24, Leu at position 27, Ala at position 28, Gly at position 29, followed by the amino acid sequence of SEQ ID NO: 1095 attached to the C-terminal amino acid at position 29, and a C-terminal amide in place of the C-terminal alpha carboxylate; and

(viii) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQID NO: 2042), HSQGTFTSDYSKYLDERRAQDFVQWLMNT (SEQ ID NO: 2041), Y(aib)EGTFISDYSIYLDRQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 2044), Y(aib)EGTFTSDX 10 SIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987), X 1 X 2 EGTFTSDX 10 SIYLDKQAAX 20 EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 2037) or X 1 X 2 EGTFTSDVSIYLDKQAAX 20 EFVNWLLAGGPSSGAPPPSX 40 (SEQ ID NO: 2038), wherein:

X 1 is His or Tyr;

X 2 is alpha-aminoisobutyric acid (Aib);

X 10 is Lys acylated with a C16 to C20 fatty acid group via a gamma Glu linker;

X 20 is alpha-aminoisobutyric acid (Aib); and

X 40 is Lys acylated with a C16 to C20 fatty acid group via a gamma Glu linker; and

(ix) X 1 X 2 X 3 GTFX 7 SDX 10 SX 12 YLX 15 X 16 X 17 AAX 20 X 21 FVX 24 WLLX 28 X 29 (SEQ ID NO: 2039), wherein:

X 1 is Tyr or His;

X 2 is Ser, D-serine, Ala, Val, glycine, N-methyl serine, aminoisobutyric acid (Aib), N-methyl alanine or D-alanine;

X 3 is Glu or Gln;

X 7 is Thr or Ile;

X 10 is Lys, Tyr or Val;

X 12 is Ser, Lys, Arg or Ile;

X 15 is Glu or Asp;

X 16 is Glu or Lys;

X 17 is Gln or Arg;

X 20 is Gln or Aib;

X 21 is Glu or Asp;

X 24 is Asn, Gln or Ala;

X 28 is Ala, Glu, or Asp;

X 29 is Ala or Gly,

wherein said insulin agonist peptide comprises an insulin A chain and an insulin B chain, wherein said insulin A chain comprises the amino acid sequence GIVX 4 X 5 CCX 8 X 9 X 10 CX 12 LX 14 X 15 LX 17 X 18 YCX 21 -R 13 (SEQ ID NO: 19), and said B chain comprises the amino acid sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20), wherein:

X 4 is glutamic acid or aspartic acid;

X 5 is glutamine or glutamic acid;

X 8 is histidine, threonine or phenylalanine;

X 9 is serine, arginine, lysine, ornithine or alanine;

X 10 is isoleucine or serine;

X 12 is serine or aspartic acid;

X 14 is tyrosine, arginine, lysine, ornithine or alanine;

X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;

X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;

X 18 is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;

X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;

X 25 is histidine or threonine;

X 29 is selected from the group consisting of alanine, glycine and serine;

X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;

X 33 is selected from the group consisting of aspartic acid and glutamic acid;

X 34 is selected from the group consisting of alanine and threonine;

X 41 is selected from the group consisting of glutamic acid, aspartic acid and asparagine;

X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;

X 45 is tyrosine or phenylalanine;

R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), FVKQ (SEQ ID NO: 8), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal amine; and

R 13 is COOH or CONH 2 ;

wherein said linear chain spacer comprises the general structure of:

wherein R 1 , R 2 , R 3 and R 4 are independently selected from the group consisting of H and CH 3 , n is 0 or 1, and m is 1, 2 or 3; and

wherein the first end of the linear chain spacer is linked to the carboxy terminus of the incretin peptide via an amide bond, and the second end is linked to the N-terminus of the insulin B chain (Q 1 ).

2. The conjugate of claim 1 , wherein the linear chain spacer comprises the general structure of:

wherein

R 2 and R 3 are each H;

R 1 and R 4 are independently H or CH 3 ; and

m is 1 or 2.

3. The conjugate of claim 2 , wherein

R 1 , R 2 , R 3 and R 4 are each H; and

m is 1 or 2.

4. The conjugate of claim 1 , wherein said A chain comprises the amino acid sequence GIVEQCCX 8 X 9 ICSLYQLENYCX 21 -R 13 (SEQ ID NO: 2040), said B chain comprises the amino acid sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20), wherein:

X 8 is histidine or threonine;

X 9 is serine, lysine, or alanine;

X 21 is alanine, glycine or asparagine;

X 25 is histidine or threonine;

X 29 is selected from the group consisting of alanine, glycine and serine;

X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;

X 33 is selected from the group consisting of aspartic acid and glutamic acid;

X 34 is selected from the group consisting of alanine and threonine;

X 41 is selected from the group consisting of glutamic acid, aspartic acid and asparagine;

X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;

X 45 is tyrosine or phenylalanine;

R 22 is selected from the group consisting of FVNQ (SEQ ID NO: 12), FVKQ (SEQ ID NO: 8), a tripeptide valine-asparagine-glutamine, a dipeptide asparagine-glutamine, glutamine and an N-terminal amine; and

R 13 is COOH or CONH 2 .

5. The conjugate of claim 4 , wherein

said incretin peptide is selected from the group consisting of: Y(aib)EGTFTSDYSIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO:1930), H(aib)QGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGAPPPS (SEQ ID NO: 1931), H(aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPS (SEQ ID NO: 1932), HSQGTFTSDYSKYLDSRRAQDFVQWLMNTGPSSGAPPPS (SEQ ID NO: 2043), Y(aib)EGTFISDYSIYLDRQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 2044), and Y(aib)EGTFTSDX 10 SIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987);

wherein X 10 is Lys acylated with a C16 fatty acid group via a gamma Glu linker;

said linear chain spacer joining the incretin to the insulin agonist peptide comprises the general structure of:

wherein R 1 , R 2 , R 3 and R 4 are independently selected from the group consisting of H and CH 3 , and m is 1, 2 or 3; and

said insulin agonist peptide comprises an A chain sequence of GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), and a B chain sequence selected from the group consisting of: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), FVNQHLCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 9), FVNQHLCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO: 5), and FVKQHLCGSHLVEALYLVCGERGFFYTEKT (SEQ ID NO: 6).

6. The conjugate of claim 5 , wherein

i) the side chain of the amino acid at position 10 of the incretin peptide further comprises a non-native alkyl or acyl group; or

ii) the side chain of the amino acid at position 24, or an added C-terminal amino acid at position 40 of the incretin peptide, or the side chain of the amino acid at position B28 or B29 of the insulin agonist peptide is linked to a hydrophilic moiety; or

iii) a combination of i) and ii).

7. The conjugate of claim 1 , wherein the insulin agonist peptide comprises:

an A chain sequence of GIVEQCCTSICSLYQLENYCN-R 13 (SEQ ID NO: 1); and

a B chain sequence selected from the group consisting of: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), FVNQHLCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 9), FVNQHLCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO: 5) and FVKQHLCGSHLVEALYLVCGERGFFYTEKT (SEQ ID NO: 6), wherein R 13 is COOH or CONH 2 ; and said linear chain spacer joining the incretin to the insulin agonist peptide comprises the general structure of:

 wherein

R 2 and R 3 are each H;

R 1 and R 4 are independently H or CH 3 ;

m is 2; and

Q 1 is the N-terminus of the insulin B chain.

8. The conjugate of claim 7 , wherein the insulin agonist peptide comprises:

an A chain sequence of GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1); and

a B chain sequence of FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2);

said incretin peptide comprises the amino acid sequence Y(aib)EGTFTSDX 10 SIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987);

wherein X 10 is Lys acylated with a C16 fatty acid group via a gamma Glu linker; and

said linear chain spacer joining the incretin to the insulin agonist peptide comprises the general structure of:

 wherein

R 1 , R 2 , R 3 and R 4 are each H; and

m is 2;

wherein the first end of the linear chain spacer is linked to the carboxy terminus of the incretin peptide via an amide bond and the second end of the linear chain spacer is linked to Q 1 , with Q 1 being the N-terminus of the insulin B chain.

9. The conjugate of claim 1 , wherein

said incretin peptide comprises the amino acid sequence Y(aib)EGTFTSDX 10 SIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987), Y(aib)EGTFTSDYSIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1930), or H(aib)QGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGAPPPS (SEQ ID NO: 1931);

wherein X 10 is Lys acylated with a C16 fatty acid group via a gamma Glu linker; and

said insulin agonist peptide comprises an A chain sequence of GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), and a B chain sequence selected from the group consisting of: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), FVNQHLCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 9), FVNQHLCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO: 5), and FVKQHLCGSHLVEALYLVCGERGFFYTEKT (SEQ ID NO: 6), and wherein the linear chain spacer comprises the general structure of:

 wherein

R 2 and R 3 are each H;

R 1 and R 4 are independently H or CH 3 ; and

m is 1 or 2.

10. The conjugate of claim 1 , wherein the insulin agonist peptide is a single chain insulin and the peptide linker joining the B and A chains is selected from the group consisting of SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 1922), SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 1923), GAGSSSX 57 X 58 (SEQ ID NO: 76), GYGSSSRR (SEQ ID NO: 61), GAGSSSRR (SEQ ID NO: 1925) and GYGSSSX 57 X 58 APQT (SEQ ID NO: 77), wherein

X 57 and X 58 are independently arginine, lysine or ornithine.

11. The conjugate of claim 1 , wherein the incretin peptide comprises the amino acid sequence X 1 X 2 EGTFTSDX 6 SSYLEEQAAKEFIAWLVK-R 4 (SEQ ID NO: 1936), or X 1 X 2 QGTFTSDYSKYLDERX 5 AKDFVX 3 WLMN-R 4 (SEQ ID NO: 1937); wherein:

X 1 is selected from the group consisting of His, D-histidine, desaminohistidine, hydroxyl-histidine, acetyl-histidine, homo-histidine, alpha, alpha-dimethyl imidiazole acetic acid (DMIA), N-methyl histidine, alpha-methyl histidine, and imidazole acetic acid;

X 2 is selected from the group consisting of Ser, D-serine, Ala, Val, glycine, N-methyl serine, aminoisobutyric acid (Aib), N-methyl alanine and D-alanine;

X 3 is selected from the group consisting of Ala, Gln and Cys-PEG;

R 4 is selected from the group consisting of Thr-CONH 2 , Cys-PEG, GGPSSGAPPPS (SEQ ID NO: 515), GGPSSGAPPPSC-PEG (SEQ ID NO: 516) and GGPSSGAPPPSCK(rEC16)C (SEQ ID NO: 1935);

X 5 is Ala or Arg and

X 6 is selected from the group consisting of valine, tyrosine and K(rEC16)C; and

wherein when X 3 is Cys-PEG, R 4 is not Cys-PEG or GGPSSGAPPPSC-PEG (SEQ ID NO: 516), and when X 2 is Ser, X 1 is not His.

12. The conjugate of claim 1 , wherein the incretin peptide comprises an analog of glucagon (SEQ ID NO: 701) having GIP agonist activity, said analog comprising one or more of the following modifications:

(a) an amino acid modification at position 1 that confers GIP agonist activity, wherein the amino acid at position 1 is an amino acid lacking an imidazole side chain;

(b) an amino acid substitution of Ser at position 16 with an amino acid of Formula IV:

wherein n is an integer from 1 to 7, wherein each of R 1 and R 2 is independently selected from the group consisting of H, C 1 -C 18 alkyl, (C 1 -C 18 alkyl)OH, (C 1 -C 18 alkyl)NH 2 , (C 1 -C 18 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , and (C 1 -C 4 alkyl)(C 3 -C 9 heteroaryl), wherein R 7 is H or OH, and the side chain of the amino acid of Formula IV comprises a free amino group,

(c) one, two, three, or all of the amino acids at positions 16, 20, 21, and 24 of the analog is substituted with an α,α-disubstituted amino acid,

(d) amino acid modifications at one, two or all of positions 27, 28 and 29, and

(e) 1-9 further amino acid modifications relative to the glucagon sequence of SEQ ID NO: 701,

wherein the EC50 of the analog for GIP receptor activation is about 10 nM or less.

13. The conjugate of claim 12 , wherein the incretin peptide comprises the following modifications: (a) the amino acid at position 1 is a Tyr, and (b) wherein (i) the Met at position 27 is substituted with Leu, (ii) the Asn at position 28 is substituted with Ala, or (iii) the Thr at position 29 is substituted with Gly, or wherein the analog comprises a combination of (i), (ii), and (iii).

14. The conjugate of claim 13 , wherein the incretin peptide further comprises one or more of the following modifications:

(a) Ser at position 2 substituted with D-Ser, Ala, D-Ala, Gly, N-methyl-Ser, Aib, Val, or α-amino-N-butyric acid;

(b) Gln at position 3 substituted with Glu;

(c) substitution of the amino acid Tyr at position 10 with an amino acid of Formula I:

wherein n is an integer from 1 to 4,

comprising a side chain covalently linked to an acyl group or alkyl group;

(d) addition of an amino acid of Formula I, comprising a side chain covalently linked to an acyl group or alkyl group at the C-terminal amino acid of the analog;

(e) Lys at position 12 substituted with Ile;

(f) Arg at position 17 substituted with Gln;

(g) Arg at position 18 substituted with Ala;

(h) Asp at position 21 substituted with Glu;

(i) Gln at position 24 substituted with Asn; or

(j) replacement of the carboxylic acid of the C-terminal amino acid with an amide.

15. The conjugate of claim 1 , wherein the incretin peptide comprises the amino acid sequence of: Y(aib)EGTFTSDX 10 SIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987), HAEGTFTSDVSSYLEEQAAREFIAWLVRGRG (SEQ ID NO: 700), HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 703), HAEGTFTSDVSSYLEGQAAKEFICWLVKGR (SEQ ID NO: 717), HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQ ID NO: 2042), HSQGTFTSDYSKYLDERRAQDFVQWLMNT (SEQ ID NO: 2041), or an analog of SEQ ID NO: 703, SEQ ID NO: 717, SEQID NO: 2042 or SEQ ID NO: 2041, wherein the incretin peptide or the analog further comprises a terminal extension of the amino acid sequence of GPSSGAPPPS (SEQ ID NO: 820) or GGPSSGAPPPS (SEQ ID NO: 515), wherein X 10 is Lys acylated with a C16 fatty acid group via a gamma Glu linker.

16. The conjugate of claim 1 , wherein

said incretin peptide comprises an amino acid sequence selected from the group consisting of: Y(aib)EGTFTSDX 10 SIYLDKQAAXEFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1987), Y(aib)EGTFTSDYSIYLDKQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 1930), H(aib)QGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGAPPPS (SEQ ID NO: 1931), H(aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPS (SEQ ID NO: 1932), HSQGTFTSDYSKYLDSRRAQDFVQWLMNTGGPSSGAPPPS (SEQ ID NO: 2043), and Y(aib)EGTFISDYSIYLDRQAA(aib)EFVNWLLAGGPSSGAPPPS (SEQ ID NO: 2044), wherein X 10 is Lys acylated with a C16 fatty acid group via a gamma Glu linker;

said insulin peptide comprises

an A chain sequence consisting of GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1); and

a B chain sequence consisting of FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2); and

said linear chain spacer joining the incretin to the insulin peptide comprises the general structure of:

 wherein

R 1 and R 2 are independently selected from H and CH 2 ,

R 3 and R 4 are each H, and

m is 2.

17. A pharmaceutical composition comprising a conjugate of claim 1 , or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.

18. An incretin-insulin conjugate comprising

an incretin peptide and

an insulin agonist peptide, wherein said conjugate has agonist activity at both the insulin receptor and an incretin receptor, and the incretin peptide is linked to the insulin agonist peptide via a linear chain spacer, wherein

said insulin agonist peptide comprises:

an A chain sequence of GIVEQCCX 8 SICSLYQLENYCX 21 (SEQ ID NO: 3); and

a B chain sequence of R 22 -HLCGSHLVEALYLVCGERGFX 45 (SEQ ID NO: 15), wherein the B chain is linked to the A chain through disulfide linkages; and

R 22 is selected from the group consisting of FVNQ (SEQ ID NO: 12), FVKQ (SEQ ID NO: 8), VNQ, NQ and Q;

X 8 is selected from the group consisting of threonine and histidine;

X 21 is selected from the group consisting of asparagine, lysine, glycine, and alanine; and

X 45 is histidine, tyrosine or phenylalanine; and

said incretin peptide comprises the sequence X 80 X 81 X 82 GTFTSDX 79 SX 83 YLX 84 X 85 X 86 X 87 AX 88 X 89 FX 90 X 91 WLX 92 X 93 X 94 (SEQ ID NO: 1928) or X 1 X 2 X 3 GTFX 7 SDX 10 SX 12 YLX 15 X 16 X 17 AAX 20 X 21 FVX 24 WLLX 28 X 29 (SEQ ID NO: 2039), wherein

the peptide of SEQ ID NO: 1928 further comprises a C-terminal extension Z 1 ; wherein:

X 1 is Tyr or His;

X 2 is Ser, D-serine, Ala, Val, glycine, N-methyl serine, aminoisobutyric acid (Aib), N-methyl alanine or D-alanine;

X 3 is Glu or Gln;

X 7 is Thr or Ile;

X 10 is Lys, Tyr or Val;

X 12 is Ser, Lys, Arg or Ile;

X 15 is Glu or Asp;

X 16 is Glu or Lys;

X 17 is Gln or Arg;

X 20 is Gln or Aib;

X 21 is Glu or Asp;

X 24 is Asn, Gln or Ala;

X 28 is Ala, Glu, or Asp;

X 29 is Ala or Gly;

X 79 is an amino acid covalently attached to a C12 to C18 acyl or alkyl group;

X 80 is His, Tyr, D-histidine, desaminohistidine, hydroxyl-histidine, acetyl-histidine, homo-histidine or alpha, alpha-dimethyl imidiazole acetic acid (DMIA) N-methyl histidine, alpha-methyl histidine, or imidazole acetic acid;

X 81 is Ser, D-serine, Ala, Val, glycine, N-methyl serine or alpha-aminoisobutyric acid (Aib), N-methyl alanine or D-alanine;

X 82 is Gln or Glu;

X 83 is Lys or Ile;

X 84 is Asp or Glu;

X 85 is Lys, Arg, Ser or Glu;

X 86 is Arg or Gln;

X 87 is Ala or Arg;

X 88 is alpha-aminoisobutyric acid (Aib), Gln or Lys;

X 89 is Asp or Glu;

X 90 is Val or Be;

X 91 is Asn, Gln or Ala;

X 92 is Leu, Val or Met;

X 93 is Ala, Asp, Lys Asn or Ala;

X 94 is Gly or Thr; and Z 1 is selected from the group consisting of —COOH, GPSSGAPPPS (SEQ ID NO: 820), KRNRNNIA (SEQ ID NO: 821) and KRNR (SEQ ID NO: 822); and

said linear chain spacer comprises the general structure of:

wherein R 1 , R 2 , R 3 and R 4 are independently selected from the group consisting of H and CH 3 , n is 0 or 1, and m is 1, 2 or 3, and

wherein the first end of the linear chain spacer is linked to the carboxy terminus of the incretin peptide via an amide bond, and the second end is linked to the N-terminus of the insulin B chain (Q 1 ).

19. The conjugate of claim 18 , wherein

X 80 is His or Tyr;

X 88 is aminoisobutyric acid (Aib); and

Z 1 is GPSSGAPPPS (SEQ ID NO: 820).

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Mar 27, 2017
From: DIMARCHI, RICHARD; LIU, FA; SMILEY, DAVID; MAYER, JOHN
To: INDIANA UNIVERSITY RESEARCH AND TECHNOLOGY CORPORATION
Reel/Frame 041751/0976 →
Continuity (2)
Provisional Application 62054666 · Sep 24, 2014
Related Publication 20170281788A1 · Oct 5, 2017
Cited By (1)
US 12,568,957