IP Library › Granted Patent US 10,350,162
Granted Patent B2
US 10,350,162 · App. 13/855,346 · Granted Jul 16, 2019

Methods and compositions for oral administration of exenatide

Inventor: Miriam Kidron (Jerusalem, IL)
Assignee: Oramed Ltd.
A61K9/0053A61K9/0031A61K9/2846A61K9/4866A61K31/202A61K31/22A61K38/26A61K38/56A61K38/57
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,350,162
App. No.
13/855,346
Granted
Jul 16, 2019
Kind
B2
Abstract

This invention provides compositions comprising a byetta, fish oil, and a protease inhibitor, method for treating diabetes mellitus, comprising administering same, and methods for oral or rectal administration of a byetta.

Claims (11)

1. A method for slowing the progression and/or ameliorating the symptoms of diabetes mellitus in a subject, comprising administering orally to said subject a pharmaceutical composition comprising an exenatide having at least 95% identity to HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 1), wherein the exenatide has glucagon-like peptide (GLP-1) agonist activity, a protease inhibitor selected from Soybean Trypsin Inhibitor (SBTI) and aprotinin, EDTA, and an omega-3 fatty acid, thereby slowing the progression and/or ameliorating the symptoms of diabetes mellitus, wherein the composition does not comprise both SBTI and aprotinin.

2. The method of claim 1 , wherein said omega-3 fatty acid is derived from fish oil.

3. The method of claim 1 , wherein said protease inhibitor is soybean trypsin inhibitor (SBTI).

4. The method of claim 1 , wherein said pharmaceutical composition further comprises a coating that inhibits digestion of said composition in a stomach of a subject.

5. The method of claim 4 , wherein said coating is an enteric coating.

6. The method of claim 1 , wherein said pharmaceutical composition further comprises a gelatin coating.

7. The method of claim 1 , wherein said protease inhibitor is aprotinin.

8. The method of claim 1 , wherein the sequence of said exenatide is identical to SEQ ID NO: 1.

9. The method of claim 1 , wherein said omega-3 fatty acid is provided in the form of a fish oil.

10. The method of claim 1 , wherein the progression of diabetes mellitus is slowed in the subject.

11. The method of claim 1 , wherein the symptoms of diabetes mellitus are ameliorated in the subject.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded May 17, 2013
From: KIDRON, MIRIAM
To: ORAMED LTD.
Reel/Frame 030442/0210 →
Continuity (3)
Division 12990097
Provisional Application 61071538 · May 5, 2008
Related Publication 20130195939A1 · Aug 1, 2013