Stabilized viral class I fusion proteins
Stable pre-fusion class I fusion proteins in the pre-fusion conformation, including one or more mutations in the hinge-loop that is present between the base helix and the RR1, are described.
1. A stable pre-fusion class I fusion protein, comprising one or more mutations in the hinge-loop that is present between the base helix and the RR1, wherein the one or more mutations comprise a mutation of one or more hydrophobic amino acid residues into Pro, and wherein the class I fusion protein is a filovirus fusion F protein, a retroviral envelope protein, or an influenza hemagglutinin (HA) protein.
2. The fusion protein according to claim 1 , wherein the class I fusion protein is an Ebola virus F protein.
3. The fusion protein according to claim 2 , comprising a mutation in the hinge loop of the amino acid residue Thr at position 577 and/or a mutation of the amino acid residue Leu at position 579.
4. The fusion protein according to claim 1 , wherein the class I fusion protein is an Ebola virus F protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 11)
GLICGLRQLANETTQALQLFLRATPELRTFSILNRKAIDFLLQR;
and
(SEQ ID NO: 12)
GLICGLRQLANETTQALQLFLRATTEPRTFSILNRKAIDFLLQR.
5. The fusion protein according to claim 1 , wherein the class I fusion protein is a Marburg virus F protein.
6. The fusion protein according to claim 5 , comprising a mutation in the hinge loop of the amino acid residue Thr at position 578, and/or a mutation of the amino acid residue Glu at position 580.
7. The fusion protein according to claim 5 , wherein the class I fusion protein is a Marburg virus F protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 15)
NLVCRLRRLANQTAKSLELLLRVTPEERTFSLINRHAIDFLLAR;
and
(SEQ ID NO: 16)
NLVCRLRRLANQTAKSLELLLRVTTEPRTFSLINRHAIDFLLAR.
8. The fusion protein according to claim 1 , wherein the class I fusion protein is a retroviral HIV-1 envelope protein.
9. The fusion protein according to claim 8 , comprising a mutation in the hinge loop of the amino acid residue Leu at position 555, a mutation of amino acid residue Leu at position 556, and/or a mutation of the amino acid residue Ala at position 558.
10. The fusion protein according to claim 8 , wherein the class I fusion protein is a HIV-1 envelope protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 3)
QARQLLSGIVQQQNNPLRAIEAQQHLLQLTVWGIKQLQARI;
(SEQ ID NO: 4)
QARQLLSGIVQQQNNLPRAIEAQQHLLQLTVWGIKQLQARI;
(SEQ ID NO: 5)
QARQLLSGIVQQQNNLLRPIEAQQEILLQLTVWGIKQLQARI;
(SEQ ID NO: 6)
QARQLLSGIVQQQSNPLRAIEAQQHMLQLTVWGIKQLQTRV;
(SEQ ID NO: 7)
QARQLLSGIVQQQSNLPRAIEAQQHMLQLTVWGIKQLQTRV;
and
(SEQ ID NO: 8)
QARQLLSGIVQQQSNLLRPIEAQQHMLQLTVWGIKQLQTRV.
11. The fusion protein according to claim 1 , wherein the class I fusion protein is a retroviral HIV-2 envelope protein.
12. The fusion protein according to claim 11 , comprising a mutation in the hinge loop of the amino acid residue Leu at position 553 and/or a mutation of amino acid residue Leu at position 554, a mutation of amino acid residue Ala at position 556, and/or a mutation of amino acid residue Val at position 557.
13. The fusion protein according to claim 11 , wherein the class I fusion protein is a HIV-2 envelope protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 31)
LLAGIVQQQQQPLDAVKRQQELLRLTVWG;
(SEQ ID NO: 32)
LLAGIVQQQQQLPDAVKRQQELLRLTVWG;
(SEQ ID NO: 33)
LLAGIVQQQQQLLDPVKRQQELLRLTVWG;
and
(SEQ ID NO: 34)
LLAGIVQQQQQLLDAPKRQQELLRLTVWG.
14. The fusion protein according to claim 1 , wherein the class I fusion protein is an influenza H1 hemagglutinin (HA) protein.
15. The fusion protein according to claim 14 , comprising a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 63 and/or a mutation of the amino acid residue Leu at position 73.
16. The fusion protein according to claim 14 , wherein the class I fusion protein is an influenza H1 hemagglutinin (HA) protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 19)
QKSTQNAINGITNKVNSVIEKMNTQPTAVGKEFNKLERRMENLNKKVDDG
FID;
and
(SEQ ID NO: 20)
QKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKPERRMENLNKKVDDG
FID.
17. The fusion protein according to claim 1 , wherein the class I fusion protein is an influenza H3 hemagglutinin (HA) protein.
18. The fusion protein according to claim 17 , comprising a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 72 and/or a mutation of the amino acid residue Val at position 82.
19. The fusion protein according to claim 17 , wherein the class I fusion protein is an influenza H3 hemagglutinin (HA) protein comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 23)
LKSTQAAINQINGKLNRLIGKTNEKPHQIEKEFSEVEGRIQDLEKYVEDT
KID;
and
(SEQ ID NO: 24)
LKSTQAAINQINGKLNRLIGKTNEKFHQIEKEFSEPEGRIQDLEKYVEDT
KID.
20. The fusion protein according to claim 1 , wherein the class I fusion protein is an influenza hemagglutinin (HA) polypeptide of an influenza B virus.
21. The fusion protein according to claim 20 , comprising a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Leu at position 62 and/or a mutation of the amino acid Leu at position 72.
22. The fusion protein according to claim 20 , wherein the class I fusion protein is an influenza hemagglutinin (HA) polypeptide of an influenza B virus comprising an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 27)
LKSTQEAINKITKNLNSLELEVKNPQRLSGAMDELHNEILELDEKVDDL
RAD;
and
(SEQ ID NO: 28)
LKSTQEAINKITKNLNSLELEVKNLQRLSGAMDEPHNEILELDEKVDDL
RAD.
23. A nucleic acid sequence encoding a protein according to claim 1 .
24. A composition comprising a protein and/or a nucleic acid according to claim 1 .
25. A composition comprising a nucleic acid according to claim 23 .