Protoxin-II variants and methods of use
The present invention relates to Protoxin-II variants, polynucleotides encoding them, and methods of making and using the foregoing.
1. An isolated Protoxin-II variant, comprising: a modified SEQ ID NO: 1, wherein amino acid numbering corresponds to amino acid numbering in SEQ ID NO: 1, comprising a W7Q substitution, a W30L substitution and a conserved M19 wherein the Protoxin-II variant is 30 or 32 amino acid residues and wherein, when the Protoxin-II variant is 32 amino acid residues, residues GP are at the amino-terminus of the Protoxin-11 variant; and
wherein the variant possess a potency comprising an IC 50 value of 3×10 −8 M or less, wherein the IC 50 value is measured using a veratridine-induced depolarization inhibition assay using fluorescence resonance energy transfer (FRET) in the presence of 25×10 −6 M 3-veratroylveracevine in HEK293 cells stably expressing human Nav1.7.
2. The isolated Protoxin-II variant of claim 1 , wherein the modified SEQ ID NO: 1 further comprises at least one of an N-terminal GP and a C-terminal extension.
3. The Protoxin-II variant of claim 2 , wherein the C-term inal extension comprises at least one of SEQ ID NOs: 374, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396 and 397.
4. The Protoxin-II variant of claim 1 , further comprising an N-terminal extension, wherein the N-terminal extension comprises at least one of SEQ ID NOs: 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384 and 385.
5. The Protoxin-II variant of claim 1 , further comprising:
an N-terminal extension; and
a linker conjugating the N-terminal to the modified SEQ ID NO: 1.
6. The Protoxin-II variant of claim 5 , wherein the linker comprises at least one of SEQ ID NOs: 383, 392, 398, 399, 400, 401 and 402.
7. The isolated Protoxin-II variant of claim 1 , wherein the modified SEQ ID NO: 1 comprises the amino acid sequence of SEQ ID NOs: 418, 419, 420, 421, 422, 423, 425, 426, 427, or 428;
wherein SEQ ID NOs: 418, 419, 425, and 428 each consist of 30 amino acid residues; and
wherein SEQ ID NOs: 420, 421, 422, 423, 426, and 427 each consist of 32 amino acid residues.
8. The isolated Protoxin-II variant of claim 1 , wherein the modified SEQ ID NO: 1 comprises a potency comprising an IC 50 value of between about 3×10 −8 M to about 1×10 −9 M.
9. The isolated Protoxin-II variant of claim 1 , further comprising at least one of a free C-terminal carboxylic acid, a free C-terminal amide, a free C-Terminal methylamide and a free C-terminal butylamide group.
10. The Protoxin-II variant of claim 1 , further comprising a half-life extending moiety conjugated to the modified SEQ ID NO: 1.
11. The Protoxin-II variant of claim 10 , wherein the half-life extending moiety comprises at least one of human serum albumin (HSA), an albumin binding domain (ABD), a Fc region, and polyethylene glycol (PEG).
12. A pharmaceutical composition comprising a therapeutically effective amount of the isolated Protoxin-II variant of claim 1 and a pharmaceutically acceptable excipient.
13. A method of treating Nav1.7-mediated pain in a subject, comprising administering to a subject in need thereof an effective amount of the Protoxin-II variant or the fusion protein of any of the claim 1 to treat the pain.
14. The method of claim 13 , wherein the pain is chronic pain, acute pain, neuropathic pain, nociceptive pain, visceral pain, back pain, post-operative pain, thermal pain, phantom limb pain, or pain associated with inflammatory conditions, primary erythemalgia (PE), paroxysmal extreme pain disorder (PEPD), osteoarthritis, rheumatoid arthritis, lumbar discectomy, pancreatitis, fibromyalgia, painful diabetic neuropathy (PDN), post-herpetic neuropathy (PHN), trigeminal neuralgia (TN), spinal cord injuries or multiple sclerosis.
15. The method of claim 14 , wherein the Protoxin-II variant is administered peripherally.
16. The method of claim 15 , wherein the Protoxin-II variant is administered locally to a joint, spinal cord, surgical wound, sites of injury or trauma, peripheral nerve fibers, urogenital organs, or inflamed tissues.
17. The method of claim 16 , wherein the subject is a human.
18. The Protoxin-II variant of claim 1 , further comprising:
a C-terminal extension selected from the group consisting of: (i) a C-terminal extension that is a sequence selected from the group consisting of SEQ ID NOs: 374, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, and 397; and (ii) a C-terminal extension that is a sequence selected from the group consisting of SEQ ID NOs: 374, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, and 397 with at least one conservative amino acid substitution therein; and
a linker conjugating the C-terminal extension to the modified SEQ ID NO: 1.
19. An isolated Protoxin-II variant, comprising an amino acid sequence that is 90% identical to the amino acid sequence of SEQ ID NO: 422 (GPYCQKVVMQTCDSERKCCEGMVCRLWCKKKLL-COON) wherein the amino sequence comprises:
a Q or W at position 7, when residue numbering is according to SEQ ID NO: 1; and
a L, F, Y, or W at position 30, when residue numbering is according to SEQ ID NO: 1, wherein the variant comprises 30 or 32 amino acids; and
a potency comprising an IC 50 value of about 30×10 −9 M or less, wherein the IC 50 value is measured using a veratridine-induced depolarization inhibition assay using fluorescence resonance energy transfer (FRET) in the presence of 25×10 −6 M 3-veratroylveracevine in HEK293 cells stably expressing human Nav1.7; and wherein the conservative amino acid substitutions are selected from the group consisting of: (1) a substitution of one acidic amino acid for another acidic amino acid, wherein the acidic amino acids are aspartic acid and glutamic acid; (2) a substitution of one basic amino acid for another basic amino acid, wherein the basic amino acids are lysine, arginine, and histidine; (3) a substitution of one nonpolar amino acid for another nonpolar amino acid, wherein the nonpolar amino acids are alanine, valine, leucine, isoleucine, phenylalanine, methionine, and tryptophan; and (4) a substitution of one uncharged polar amino acid for another uncharged polar amino acid, wherein the uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, and tyrosine.
20. The Protoxin-II variant of claim 19 , wherein the variant is selected from the group consisting of SEQ ID NOs: 408, 409, 410, 422, 424, 425, 426, 427, and 428.