Chimeric antigen receptor molecules and uses thereof
Chimeric antigen receptor (CAR) polypeptides are provided comprising an antigen binding domain; a hinge domain; a transmembrane domain and an intracellular signaling domain, wherein the CAR polypeptide binds to a target antigen and wherein the antigen binding domain comprises HCDR sequences from a first antibody that binds to the target antigen and LCDR sequences from a second antibody that binds to the target antigen. In certain aspects, the target antigen is CD123.
1. A chimeric antigen receptor (CAR) polypeptide comprising, from N- to C-terminus, an antigen binding domain; a hinge domain; a transmembrane domain and an intracellular signaling domain, wherein the CAR polypeptide binds to a target antigen and wherein the antigen binding domain comprises HCDR sequences from a first antibody that binds to the target antigen and LCDR sequences from a second antibody that binds to the target antigen, wherein the target antigen is CD123, wherein the antigen binding domain comprises:
(i) a heavy chain variable region (VH) having a VHCDR1 amino acid sequence comprising SEQ ID NO: 33, a VHCDR2 amino acid sequence comprising SEQ ID NO: 34, and a VHCDR3 amino acid sequence comprising SEQ ID NO: 35; and a light chain variable region (VL) having a VLCDR1 amino acid sequence comprising SEQ ID NO: 24, a VLCDR2 amino acid sequence comprising SEQ ID NO: 25, and a VLCDR3 amino acid sequence comprising SEQ ID NO: 26;
(ii) a heavy chain variable region (VH) having a VHCDR1 amino acid sequence comprising SEQ ID NO: 27, a VHCDR2 amino acid sequence comprising SEQ ID NO: 28, and a VHCDR3 amino acid sequence comprising SEQ ID NO: 29; and a light chain variable region (VL) having a VLCDR1 amino acid sequence comprising SEQ ID NO: 24, a VLCDR2 amino acid sequence comprising SEQ ID NO: 25, and a VLCDR3 amino acid sequence comprising SEQ ID NO: 26;
(iii) a heavy chain variable region (VH) having a VHCDR1 amino acid sequence comprising
SEQ ID NO: 39, a VHCDR2 amino acid sequence comprising SEQ ID NO: 40, and a VHCDR3 amino acid sequence comprising SEQ ID NO: 41; and a light chain variable region (VL) having a VLCDR1 amino acid sequence comprising SEQ ID NO: 36, a VLCDR2 amino acid sequence comprising SEQ ID NO: 37, and a VLCDR3 amino acid sequence comprising SEQ ID NO: 38; or
(iv) a heavy chain variable region (VH) having a VHCDR1 amino acid sequence comprising SEQ ID NO: 21, a VHCDR2 amino acid sequence comprising SEQ ID NO: 22, and a VHCDR3 amino acid sequence comprising SEQ ID NO: 23; and a light chain variable region (VL) having a VLCDR1 amino acid sequence comprising SEQ ID NO: 30, a VLCDR2 amino acid sequence comprising SEQ ID NO: 31, and a VLCDR3 amino acid sequence comprising SEQ ID NO: 32.
2. The polypeptide of claim 1 , wherein the hinge domain is a CD8a hinge having a sequence comprising KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD (SEQ ID NO: 12) or an IgG4 hinge having a sequence comprising ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO: 13).
3. The polypeptide of claim 1 , wherein the transmembrane domain is a CD8a transmembrane domain having a sequence comprising FACDIYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 14) or a CD28 transmembrane domain having a sequence comprising FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 15).
4. The polypeptide of claim 1 , wherein the intracellular signaling domain comprises a CD3z intracellular signaling domain having a sequence comprising RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 16).
5. A nucleic acid molecule encoding a CAR polypeptide in accordance with claim 1 .
6. The nucleic acid molecule of claim 5 , wherein the sequence encoding the CAR polypeptide is operatively linked to expression control sequences.
7. An isolated immune effector cell comprising a CAR polypeptide in accordance with claim 1 .
8. The cell of claim 7 , wherein the nucleic acid is integrated into the genome of the cell.
9. The cell of claim 7 , wherein the cell is a T-cell.
10. The cell of claim 7 , wherein the cell is a human cell.
11. A pharmaceutical composition comprising a population of cells in accordance with claim 10 in a pharmaceutically acceptable carrier.
12. A method of treating a subject comprising administering an anti-tumor effective amount of chimeric antigen receptor (CAR) T-cells that expresses a CAR polypeptide according to claim 1 .
13. The method of claim 12 , wherein the CAR-T cells are allogeneic cells.
14. The method of claim 12 , wherein the CAR-T cells are autologous cells.
15. The method of claim 12 , wherein the CAR-T cells are HLA matched to the subject.
16. The method of claim 12 , wherein the subject has a cancer.