IP Library Granted Patent US 11,066,459
Granted Patent B2
US 11,066,459 · App. 15/125,774 · Granted Jul 20, 2021

Hybrid immunoglobulin containing non-peptidyl linkage

Inventor: Daniel J. Capon (Hillsborough, CA)
Assignee: BIOMOLECULAR HOLDINGS LLC
C07K16/00A61K47/6801A61K47/6855A61K47/6875A61K47/6889C07K16/241C07K16/46C07K2317/21C07K2317/52C07K2317/55C07K2317/76
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 11,066,459
App. No.
15/125,774
Granted
Jul 20, 2021
Kind
B2
Abstract

The present invention provides a compound having the structure: A-B - - - Z wherein A is a biologically active structure of the compound; wherein Z is a protein component of the compound, which protein component comprises one or more polypeptides, wherein at least one of the one or more polypeptides comprises consecutive amino acids which (i) are identical to a stretch of consecutive amino acids present in a chain of an F c domain of an antibody; (ii) bind to an F c receptor; and (iii) have at their N-terminus a sequence selected from the group consisting of a cysteine or selenocysteine; wherein the dashed line between B and Z represents a peptidyl linkage; and wherein the solid line between A and B represents a nonpeptidyl linkage, as well as intermediates dimers thereof, and processes of producing the compounds of the invention.

Claims (92)

1. A compound having the structure:

A-B - - - Z

wherein A is a biologically active structure of the compound;

wherein Z is a protein component of the compound, which protein component comprises one or more polypeptides, wherein at least one of the one or more polypeptides comprises consecutive amino acids which (i) are identical to a stretch of consecutive amino acids present in a chain of an F c domain of an antibody; (ii) bind to an F c receptor; and (iii) have at their N-terminus a cysteine or a selenocysteine;

wherein B is (a) an organic acid residue or (b) a stretch of consecutive amino acid residues which is, or is present in any of the following sequences: EPKSCDKTHTCPPCP (SEQ ID NO: 213), ERKCCVECPPCP (SEQ ID NO: 214), ELKTPLGDTTHTCPRCP(EPKSCDTPPPCPRCP)3 (SEQ ID NO: 215), or ESKYGPPCPSC (SEQ ID NO: 216);

wherein the dashed line between B and Z represents a peptidyl linkage between the N-terminal cysteine or selenocysteine of Z and an amino acid residue or an organic acid residue of B; and

wherein the solid line between A and B represents a nonpeptidyl linkage comprising the structure:

wherein X a is a chemical structure containing a cyclooctane fused to a dihydropyridazine; and

wherein R a represents an organic structure which connects to A and R b represents an organic structure which comprises

and connects to B, wherein X 1 is CH or N, and X 2 is CH 2 or a carbonyl group.

2. The compound according to claim 1 , wherein X a has the structure:

wherein R c is H, alkyl or aryl;

or a tautomer thereof.

3. The compound according to claim 1 , wherein R a is connected to the cyclooctane and R b is connected to the dihydropyridazine.

4. The compound according to claim 1 , wherein the solid line between A and B represents a nonpeptidyl linkage comprising the structure:

wherein R c is H, alkyl or aryl;

or a tautomer thereof.

5. The compound according to claim 1 , wherein R a is a bond or an organic structure comprising or consisting of a chain of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more moieties, wherein each moiety is independently selected from the group consisting of [PEG(y)]z, polyalkylene glycol, polyoxyalkylated polyol, polyvinyl alcohol, polyvinyl alkyl ether, poly(lactic acid), poly(lactic-glycolic acid), polysaccharide, a branched residue, C 1 -C 10 alkyl, C 3 -C 10 cycloalkane, C 2 -C 10 alkene, C 5 -C 10 cycloalkene, amine, sulfur, oxygen, succinimide, maleimide, glycerol, triazole, isoxazolidine, C 2 -C 5 acyl, C 2 -C 5 acylamino, C 2 -C 5 acyloxy, succinyl, malonyl, glutaryl, phthalyl, adipoyl, an amino acid, an aryl group, a heteroaryl group, a carbamate, a chemical structure containing a cyclooctane fused to a dihydropyridazine, a chemical structure containing a cyclooctene fused to a triazole, a chemical structure containing a cyclooctene fused to a isoxazolidine, a dibenzocyclooctene, a dibenzoazacyclooctene,

wherein X 1 is CH or N, X 2 is CH 2 or a carbonyl group, and R 5 is an aryl or alkyl group;

wherein [PEG(y)]z is:

wherein y=1-100 and z=1-10.

6. The compound according to claim 1 , wherein R a

i) is attached to A via a carbon-nitrogen bond or a carbon-sulfur bond;

ii) is attached to A via a carbon-nitrogen bond;

iii) is attached to A via a carbon-nitrogen bond, wherein the carbon-nitrogen bond is an amide bond;

iv) is attached to A via a biologically labile bond;

v) is attached to A via an amide bond between the C-terminal amino acid of A and an amino group in B;

vi) is attached to A via an amide bond between the C-terminal amino acid of A and an amino group in B, wherein the terminal amino acid is cysteine;

vii) is attached to A via a carbon-sulfur bond;

viii) is attached to A via a carbon-sulfur bond formed between R 2 and a free thiol;

ix) is is attached to A via a succinimide-sulfur bond;

x) comprises a branched residue; or

xi) is attached to more than one A via the branched residue.

7. The compound according to claim 1 , wherein A

i) comprises the structure of a compound that is a drug approved for treating a subject afflicted with a disease;

ii) comprises the structure of an organic compound having a molecular weight less than 1000 Daltons, a DNA aptamer, an RNA aptamer, an oligonucleotide, or a protein that is biologically active;

iii) comprises a primary or a secondary amine;

iv) is linked to B via the primary or secondary amine;

v) is aripiprazole or oseltamivir;

vi) comprises a secondary amine;

vii) is a respiratory drug, an antiasthmatic agent, an analgesic agent, an antidepressant, an antianginal agent, an antiarrhythmic agent, an antihypertensive agent, an antidiabetic agent, an antihistamine, an anti-infective agent, an antibiotic, an antiinflamatory agent, an antiparkinsonism drug, an antipsychotics, an antipyretic agent, an antiulcer agent, an attention deficit hyperactivity disorder (ADHD) drug, a central nervous system stimulant, a decongestant, or a psychostimulant;

viii) is alprenolol, acebutolol, amidephrine, amineptine, amosulalol, amoxapine, amphetaminil, atenolol, atomoxetine, balofloxacin, bamethan, befunolol, benazepril, benfluorex, benzoctamine, betahistine, betaxolol, bevantolol, bifemelane, bisoprolol, brinzolamide, bufeniode, butethamine, camylofine, carazolol, carticaine, carvedilol, cephaeline, ciprofloxacin, clozapine, clobenzorex, clorprenaline, cyclopentamine, delapril, demexiptiline, denopamine, desipramine, desloratadine, diclofenac, dimetofrine, dioxadrol, dobutamine, dopexamine, doripenem, dorzolamide, droprenilamine, duloxetine, eltopraZine, enalapril, enoxacin, epinephrine, ertapenem, esapraZole, esmolol, etoxadrol, fasudil, fendiline, fenethylline, fenfluramine, fenoldopam, fenoterol, fenproporex, flecamide, fluoxetine, formoterol, frovatriptan, gaboxadol, garenoxacin, gatifloxacin, grepafloxacin, hexoprenaline, imidapril, indalpine, indecainide, indeloxazine hydrochloride, isoxsuprine, ispronicline, labetalol, landiolol, lapatinib, levophacetoperane, lisinopril, lomefloxacin, lotrafiban, maprotiline, mecamylamine, mefloquine, mepindolol, meropenem, metapramine, metaproterenol, methoxyphenamine, dextrorotary methylphenidate, methylphenidate, metipranolol, metoprolol, mitoxantrone, mivazerol, moexipril, moprolol, moxifloxacin, nebivolol, nifenalol, nipradilol, norfloxacin, nortriptyline, nylidrin, olanZapine, oxamniquine, oxprenolol, oxyfedrine, paroxetine, perhexyline, phenmetrazine, phenylephrine, phenylpropylmethylamine, pholedrine, picilorex, pimethylline, pindolol, pipemidic acid, piridocaine, practolol, pradofloxacin, pramipexole, pramiverin, prenalterol, prenylamine, prilocalne, procaterol, pronethalol, propafenone, propranolol, propylhexedrine, protokylol, protriptyline, pseudoephedrine, reboxetine, rasagiline, (r)-rasagiline, repinotan, reproterol, rimiterol, ritodrine, safinamide, salbutamol/albuterol, salmeterol, sarizotan, sertraline, silodosin, sotalol, soterenol, sparfloxacin, spirapril, sulfinalol, synephrine, tamsulosin, tebanicline, tianeptine, tirofiban, tretoquinol, trimetazidine, troxipide, varenicline, vildagliptin, viloxazine, viquidil or xamoterol;

ix) comprises a protein that is biologically active;

x) comprises a secreted protein;

xi) comprises an extracellular domain of a protein

xii) is biologically active such that it has target-binding activity;

xiii) is an independently-folding protein or a portion thereof;

xiv) is a glycosylated protein;

xv) comprises intra-chain disulfide bonds;

xvi) binds a cytokine;

xvii) binds to a cytokine, wherein the cytokine is TNFα;

xviii) comprises Atrial Natriuretic Peptide (ANP), Calcitonin, Corticotropin Releasing Hormone (CRH), Endothelin, Exenatide, Gastric Inhibitory Peptide (GIP), Glucagon-Like Peptide-1 (GLP-1), Glucagon-Like Peptide-2 (GLP-2), an analog of GLP-1 or GLP-2, Glucagon Vasoactive Intestinal Peptide (GVIP), Ghrelin, Peptide YY or Secretin, or a portion thereof;

xix) comprises a stretch of consecutive amino acids in the sequence HGEGTFTSDVSSYLEEQAAKEFIAWLVKGRG (SEQ ID NO: 202);

xx) comprises at least one stretch of consecutive amino acids which are identical to a stretch of consecutive amino acids present in the heavy chain of a Fab or a Fab′ of an antibody;

xxi) comprises at least one at least one stretch of consecutive amino acids which are identical to a stretch of consecutive amino acids present in the light chain of a Fab or a Fab′ of an antibody;

xxii) comprises at least one Fab or Fab′ of an antibody, or a portion of at least one Fab or Fab′;

xxiii) comprises Fab-1 or Fab′1, or a portion thereof of an antibody;

xxiv) comprises Fab-2 or Fab′2, or a portion thereof of an antibody;

xxv) comprises two Fab or Fab′ hands of an antibody;

xxvi) comprises at least one stretch of consecutive amino acids which are identical to a stretch of consecutive amino acids present in a single chain antibody; or

xxvii) comprises at least one stretch of consecutive amino acids which are identical to a stretch of consecutive amino acids present in a TNFα receptor.

8. The compound according to claim 1 , wherein Z comprises one C, wherein C is a first polypeptide, which first polypeptide comprises consecutive amino acids which (i) are identical to a stretch of consecutive amino acids present in a chain of an F c domain of an antibody; (ii) bind to an F e receptor; and (iii) have at their N-terminus a sequence selected from the group consisting of a cysteine, selenocysteine, CP, CPXCP (where X═P, R, or S) (SEQ ID NOs: 206-208), CDKTHTCPPCP (SEQ ID NO: 209), CVECPPCP (SEQ ID NO: 210), CCVECPPCP(SEQ ID NO: 211) and CDTPPPCPRCP (SEQ ID NO: 212), and wherein B is linked to Z via a peptidyl linkage between the N-terminal cysteine or selenocysteine of first polypeptide component C and an amino acid residue or an organic acid residue of B.

9. The compound according to claim 8 , wherein C

i) comprises consecutive amino acids which (i) are identical to a stretch of consecutive amino acids present in a chain of an F c domain of an antibody; (ii) bind to an F c receptor; and (iii) have at their N-terminus a sequence comprising a naturally occurring cysteine selected from the group consisting of CP, CPXCP (where X═P, R, or S) (SEQ ID NOs: 206-208), CDKTHTCPPCP (SEQ ID NO: 209), CVECPPCP (SEQ ID NO: 210), CCVECPPCP (SEQ ID NO: 211) and CDTPPPCPRCP (SEQ ID NO: 212);

ii) is a polypeptide component of the compound, which polypeptide component comprises consecutive amino acids which (i) are identical to a stretch of consecutive amino acids present in a chain of an F c domain of an antibody;

(ii) bind to an F c receptor; and (iii) have at their N-terminus a sequence comprising a non-naturally occurring cysteine or selenocysteine;

iii) comprises consecutive amino acids which are identical to a stretch of consecutive amino acids present in the chain of an Fc domain of an antibody selected from the group consisting of IgG, IgM, IgA, IgD, and IgE;

iv) comprises consecutive amino acids which are identical to a stretch of consecutive amino acids present in the chain of an Fc6 domain of an antibody

vi) comprises consecutive amino acids which are identical to a stretch of consecutive amino acids present in a chain of an antibody other than a chain of a Fc domain of the antibody;

vi) consecutive amino acids which are identical to a stretch of consecutive amino acids present in a heavy chain of a Fab or a Fab′ of an antibody; or

vii) comprises consecutive amino acids which are identical to a stretch of consecutive amino acids present in the light chain of a Fab or a Fab′ of an antibody.

10. The compound according to claim 8 , wherein Z further comprises a second polypeptide, which second polypeptide comprises consecutive amino acids which are identical to a stretch of consecutive amino acids present in a chain of an antibody other than a chain of a Fc domain of the antibody.

11. The compound according to claim 10 , wherein the second polypeptide comprises

i) consecutive amino acids which are identical to a stretch of consecutive amino acids present in a heavy chain of a Fab or a Fab′ of an antibody; or

ii) consecutive amino acids which are identical to a stretch of consecutive amino acids present in the light chain of a Fab or a Fab′ of an antibody.

12. The compound according to claim 1 , wherein Z

i) comprises an antibody or a portion thereof;

ii) comprises at least one Fab or Fab′ of an antibody, or a portion of the at least one Fab or Fab′

iii) comprises Fab-1 or Fab′1, or a portion thereof of an antibody;

iv) comprises Fab-2 or Fab′2, or a portion thereof of an antibody;

v) comprises two Fab or Fab′ hands of an antibody;

vi) comprises at least one stretch of consecutive amino acids which are identical to a stretch of consecutive amino acids present in a single chain antibody; or

vii) comprises a second polypeptide, and B is linked to Z via a peptidyl linkage between the N-terminal cysteine or selenocysteine of the second polypeptide of Z and an amino acid residue or an organic acid residue of B.

13. The compound according to claim 8 , wherein the C-terminus of C

i) comprises a stretch of consecutive amino acids present in a chain of an F c domain of an antibody that has been modified; or

ii) is a cysteine, selenocysteine, homocysteine, or homoselenosysteine, or a derivative of cysteine, selenocysteine, homocysteine, or homoselenosysteine.

14. A homodimer or a heterodimer comprising the compound of claim 1 .

15. The homodimer or heterodimer of claim 14 , wherein each compound of the homodimer or heterodimer

i) is capable of binding to the other by at least one disulfide bond;

ii) is capable of binding to the other by at least one disulfide bond between the C or the second polypeptide of each compound;

iii) is bound to the other by at least one disulfide bond;

iv) is bound to the other by at least one disulfide bond between the C or the second polypeptide of each compound.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 7, 2020
From: CAPON, DANIEL J.
To: BIOMOLECULAR HOLDINGS LLC
Reel/Frame 051756/0403 →
Continuity (2)
Provisional Application 61953650 · Mar 14, 2014
Related Publication 20170008950A1 · Jan 12, 2017
Cited By (1)
US 12,473,363