Insulin conjugates
The present invention relates to a conjugate comprising a sulfonamide of formula (I) and an active pharmaceutical ingredient such as an insulin analog comprising at least one mutation relative to the parent insulin, wherein the insulin analog comprises a mutation at position B16 which is substituted with a hydrophobic amino acid and/or a mutation at position B25 which is substituted with a hydrophobic amino acid. The present invention further relates to a sulfonamide of formula (A). Moreover, the present invention relates to an insulin analog comprising at least one mutation relative to the parent insulin.
1. An insulin comprising a chain A and a chain B, wherein the insulin comprises:
(a) a mutation in chain A at position A14, or at positions A14 and A21, wherein position A14 is substituted with Glutamic Acid (Glu), Aspartic acid (Asp), or Histidine (His); and
(b) at least one a mutation in the chain B at position B25, or at position B25 in combination with positions B3, B16 and/or B30 wherein position B16 and/or B25 is substituted with a branched-chain amino acid,
wherein the insulin has two to six mutations relative to human insulin.
2. The insulin of claim 1 , wherein the branched-chain amino acid of each mutation is independently selected from the group consisting of valine (Val), isoleucine (Ile), and leucine (Leu).
3. The insulin of claim 1 , wherein the mutation at position A14 of the A chain is a substitution of A14 with glutamic acid (Glu).
4. The insulin of claim 1 , wherein the mutation at position B30 of the B chain is a deletion of the amino acid at position B30 (Des (B30)-mutation).
5. The insulin of claim 1 , wherein the mutation at position B3 of the B chain is a substitution at position B3 with glutamic acid (Glu).
6. The insulin of claim 1 , wherein the mutation at position A21 of the A chain is a substitution at position A21 with glycine (Gly).
7. The insulin of claim 1 , wherein the B chain comprises an amino acid sequence selected from the group consisting of:
(SEQ ID NO: 22)
FVNQHLCGSHLVEALYLVCGERGELYTPK,
(SEQ ID NO: 44)
FVNQHLCGSHLVEALYLVCGERGFIYTPK,
(SEQ ID NO: 48)
FVNQHLCGSHLVEALYLVCGERGFVYTPK,
(SEQ ID NO: 50)
FVEQHLCGSHLVEALYLVCGERGFVYTPK,
(SEQ ID NO: 58)
FVNQHLCGSHLVEALILVCGERGFIYTPK,
(SEQ ID NO: 60)
FVEQHLCGSHLVEALILVCGERGFIYTPK,
(SEQ ID NO: 64)
FVNQHLCGSHLVEALILVCGERGFVYTPK,
(SEQ ID NO: 66)
FVEQHLCGSHLVEALILVCGERGFVYTPK,
(SEQ ID NO: 70)
FVNQHLCGSHLVEALVLVCGERGFIYTPK,
(SEQ ID NO: 76)
FVNQHLCGSHLVEALVLVCGERGFVYTPK,
(SEQ ID NO: 78)
FVEQHLCGSHLVEALVLVCGERGFVYTPK,
(SEQ ID NO: 80)
FVEQHLCGSHLVEALVLVCGERGFVYTPK,
(SEQ ID NO: 85)
FVNQHLCGSHLVEALYLVCGERGELYTPKT,
(SEQ ID NO: 86)
FVNQHLCGSHLVEALYLVCGERGFVYTPKT,
(SEQ ID NO: 87)
FVNQHLCGSHLVEALYLVCGERGFIYTPKT,
(SEQ ID NO: 88)
FVNQHLCGSHLVEALYLVCGERGFVYTPKT,
(SEQ ID NO: 89)
FVEQHLCGSHLVEALYLVCGERGFVYTPKT,
(SEQ ID NO: 90)
FVNQHLCGSHLVEALILVCGERGFIYTPKT,
(SEQ ID NO: 91)
FVEQHLCGSHLVEALILVCGERGFIYTPKT,
(SEQ ID NO: 92)
FVNQHLCGSHLVEALILVCGERGFVYTPKT,
(SEQ ID NO: 93)
FVEQHLCGSHLVEALILVCGERGFVYTPKT,
(SEQ ID NO: 94)
FVNQHLCGSHLVEALVLVCGERGFIYTPKT,
(SEQ ID NO: 95)
FVNQHLCGSHLVEALVLVCGERGFVYTPKT,
(SEQ ID NO: 96)
FVEQHLCGSHLVEALVLVCGERGFVYTPKT,
and
(SEQ ID NO: 97)
FVEQHLCGSHLVEALVLVCGERGFVYTPKT.
8. The insulin of claim 1 , wherein the A chain has an amino acid sequence as shown in SEQ ID NO: 43 and the B chain has an amino acid sequence as shown in SEQ ID NO: 44.
9. The insulin of claim 1 , wherein the A chain has an amino acid sequence as shown in SEQ ID NO: 47 and the B chain has an amino acid sequence as shown in SEQ ID NO: 48.
10. The insulin of claim 1 , wherein the A chain has an amino acid sequence as shown in SEQ ID NO: 77 and the B chain has an amino acid sequence as shown in SEQ ID NO: 78.
11. The insulin of claim 1 , wherein the mutation at position A21 of the A chain is a substitution at position A21 with Aspartic acid (Asp).
12. The insulin of claim 1 , wherein the mutation at position A21 of the A chain is a substitution at position A21 with Histidine (His).
13. The insulin of claim 1 , wherein the branched-chain amino acid of each mutation is valine (Val).
14. The insulin of claim 1 , wherein the branched-chain amino acid of each mutation is isoleucine (Ile).
15. The insulin of claim 1 , wherein the branched-chain amino acid of each mutation is leucine (Leu).
16. An insulin selected from the group consisting of:
Glu(A14)Leu(B16)Des(B30)-human insulin,
Glu(A14)Ile(B16)Des(B30)-human insulin,
Glu(A14)Val(B16)Des(B30)-human insulin,
Glu(A14)Leu(B16)-human insulin,
Glu(A14)Ile(B16)-human insulin,
Glu(A14)Val(B16)-human insulin,
Glu(A14)Leu(B25)Des(B30)-human insulin,
Glu(A14)Ile(B25)Des(B30)-human insulin,
Glu(A14)Val(B25)Des(B30)-human insulin,
Glu(A14)Leu(B25)-human insulin,
Glu(A14)Ile(B25)-human insulin,
Glu(A14)Val(B25)-human insulin,
Glu(A14)Gly(A21)Glu(B3)Val(B25)Des(B30)-human insulin,
Glu(A14)Ile(B16)Ile(B25)Des(B30)-human insulin,
Glu(A14)Glu(B3)Ile(B16)Ile(B25)Des(B30)-human insulin,
Glu(A14)Ile(B16)Val(B25)Des(B30)-human insulin,
Glu(A14)Gly(A21)Glu(B3)Ile(B16)Val(B25)Des(B30)-human insulin,
Glu(A14)Val(B16)Ile(B25)Des(B30)-human insulin,
Glu(A14)Val(B16)Val(B25)Des(B30)-human insulin,
Glu(A14)Glu(B3)Val(B16)Val(B25)Des(B30)-human insulin,
Glu(A14)Gly(A21)Glu(B3)Val(B16)Val(B25)Des(B30)-human insulin,
Glu(A14)Gly(A21)Glu (B3)Val(B25)-human insulin,
Glu(A14)Ile(B16)Ile(B25)-human insulin,
Glu(A14)Glu(B3)Ile(B16)Ile(B25)-human insulin,
Glu(A14)Ile(B16)Val(B25)-human insulin,
Glu(A14)Gly(A21)Glu(B3)Ile(B16)Val(B25)-human insulin,
Glu(A14)Val(B16)Ile(B25)-human insulin,
Glu(A14)Val(B16)Val(B25)-human insulin,
Glu(A14)Glu(B3)Val(B16)Val(B25)-human insulin, and
Glu(A14)Gly(A21)Glu(B3)Val(B16)Val(B25)-human insulin.
17. An insulin comprising Glu(A14)Val(B25)Des(B30)-human insulin.
18. An insulin comprising Glu(A14)Ile(B25)Des(B30)-human insulin.
19. An insulin comprising Glu(A14)Val(B16) Val(B25)Des(B30)-human insulin.
20. The insulin of claim 1 , wherein the insulin comprises two to five mutations in amino acid sequence.
21. The insulin of claim 1 , wherein the insulin comprises two to four mutations in amino acid sequence.