IP Library › Granted Patent US 12,195,524
Granted Patent B2
US 12,195,524 · App. 17/409,260 · Granted Jan 14, 2025

Multi-specific antigen binding molecules targeting HIV and methods of use

Inventors: Manuel Baca (Lexington, MA); Brian A. Carr (Foster City, CA); Sheila B. Clancy (Pacifica, CA); Craig S. Pace (Pacifica, CA); Heather T. Stephenson (San Jose, CA); Nathan D. Thomsen (Castro Valley, CA)
Assignee: Gilead Sciences, Inc.
C07K16/1063A61P31/18C07K16/2809A61K2039/505C07K2317/24C07K2317/31C07K2317/55C07K2317/622C07K2317/92C07K2317/94
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,195,524
App. No.
17/409,260
Granted
Jan 14, 2025
Kind
B2
Abstract

Provided are multi-specific antigen binding molecules, including bispecific antibodies, that bind to CD3 and an HIV antigen, including HIV envelope protein gp120. Also provided are methods of using such antigen binding molecules to treat or prevent HIV infection.

Claims (54)

1. A multi-specific antigen binding molecule that binds to human CD3 and an HIV antigen, wherein the antigen binding molecule comprises:

(a) a first antigen binding domain that comprises a first heavy chain variable domain (VH) and a first light chain variable domain (VL), wherein the first antigen binding domain binds to CD3 and comprises a first VH-complementarity determining region (CDR) 1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively:

(i) SEQ ID NOs: 1, 11, 8, 4, 9 and 10; or

(ii) SEQ ID NOs: 1, 12, 8, 4, 9 and 10,

wherein the first VH and the first VL comprise the amino acid sequences of SEQ ID NOs: 51 and 56, respectively, or comprise amino acid sequences that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs: 51 and 56; and

(b) the second antigen binding domain comprises one or more extracellular (EC) domains of CD4.

2. The multi-specific antigen binding molecule of claim 1 , wherein the one or more EC domains of CD4 comprise an amino acid sequence as set forth below, or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence selected from the group consisting of:

(i)

(SEQ ID NO: 746)

KKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTKGPSK

LNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLVVVG;

(ii)

(SEQ ID NO: 747)

KKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTKGPSK

LNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLVVVGG

GGSGKKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTK

GPSKLNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLV

VVG;

(iii) 

(SEQ ID NO: 748)

KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK

LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFG;

or

(iv)

(SEQ ID NO: 749)

KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK

LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGG

GGSGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTK

GPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLL

VFG.

3. The multi-specific antigen binding molecule of claim 2 , wherein the EC domain of CD4 comprises an amino acid sequence of SEQ ID NO: 746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence of SEQ ID NO: 746.

4. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises a first VH-CDR1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively: SEQ ID NOs: 1, 11, 8, 4, 9 and 10; or SEQ ID NOs: 1, 12, 8, 4, 9 and 10; and the second antigen binding domain comprises one or more EC domains of CD4 comprising an amino acid sequence that comprises or is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domains of CD4 selected from the group consisting of SEQ ID NOs: 746-749.

5. The multi-specific antigen binding molecule of claim 4 , wherein the first antigen binding domain comprises a first VH-CDR1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively: SEQ ID NOs: 1, 12, 8, 4, 9 and 10; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO:746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domain of CD4 of SEQ ID NO: 746.

6. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises a first VH and a first VL comprising the amino acid sequences set forth, respectively, or comprising amino acid sequences that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs: 51 and 56; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO:746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domain of CD4 of SEQ ID NO: 746.

7. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1 or IgG4, comprising a first Fc region and a second Fc region.

8. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1 or IgG4, comprising a first Fc region and a second Fc region, comprising the following amino acids at the indicated positions (EU numbering):

(i) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R);

(ii) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), an arginine at position 435 (H435R) and a phenylalanine at position 436 (Y436F);

(iii) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), and a valine at position 407 (Y407V); and the second Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W);

(iv) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a leucine at position 428 (M428L) and a serine at position 434 (N434S); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R); or

(v) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a tyrosine at position 252 (M252Y), a threonine at position 254 (S254T) and a glutamic acid at position 256 (T256E); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R).

9. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1, comprising a first Fc region and a second Fc region, comprising the following amino acids at the indicated positions (EU numbering): the first Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R); and the second Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a tyrosine at position 252 (M252Y), a threonine at position 254 (S254T) and a glutamic acid at position 256 (T256E).

10. The multi-specific antigen binding molecule of claim 8 , comprising a heterodimeric human IgG1, comprising a first Fc region and a second Fc region, comprising amino acid sequences of SEQ ID NOs.: 703 and 705, or that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs.: 703 and 705.

11. The multi-specific antigen binding molecule of claim 1 , wherein the multi-specific antigen binding molecule is a bispecific antigen binding molecule.

12. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain has reduced or insignificant or substantially no binding to Protein A, or does not detectably bind to Protein A.

13. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to Protein A with a KD of greater than 10 −6 M.

14. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to CD3 with a KD of lower than 10 nM.

15. The multi-specific antigen binding molecule of claim 1 , wherein the antigen binding molecule has a serum half-life in a human or cynomolgus monkey of at least 3 days.

16. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to CD3 with a K D of lower than 7.0 nM, and the antigen binding molecule has a serum half-life in a human or cynomolgus monkey of at least at least 5 days.

17. A pharmaceutical composition comprising one or more of the multi-specific antigen binding molecules claimed in claim 1 , and a pharmaceutically acceptable carrier.

18. A kit comprising one or more containers comprising one or more of the multi-specific antigen binding molecules claimed in claim 1 .

19. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain comprises the first VH and the first VL comprising the amino acid sequences set forth, respectively, in SEQ ID NOs: 51 and 56.

20. The multi-specific antigen binding molecule of claim 2 , wherein the EC domain of CD4 comprises an amino acid sequence of SEQ ID NO: 746.

21. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises the first VH and the first VL comprising the amino acid sequences set forth, respectively, in SEQ ID NOs: 51 and 56; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO: 746.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 23, 2021
From: BACA, MANUEL; BLAIR, WADE S.; CARR, BRIAN A.; CLANCY, SHEILA B.; GOLDSMITH, JOSHUA; HUNG, MAGDELEINE S.; KANWAR, MANU; MOLDT, BRIAN; NAGEL, MARK; PACE, CRAIG S.; PAN, YENRU; STEPHENSON, HEATHER T.; THOMSEN, NATHAN D.
To: GILEAD SCIENCES, INC.
Reel/Frame 058228/0212 →
Continuity (3)
Provisional Application 63163713 · Mar 19, 2021
Provisional Application 63070141 · Aug 25, 2020
Related Publication 20230056252A1 · Feb 23, 2023
References Cited (75)
US 5624821A · Winter et al. · 1997 [cited by applicant]
US 5648260A · Winter et al. · 1997 [cited by applicant]
US 6491916B1 · Bluestone et al. · 2002 [cited by applicant]
US 8088376B2 · Chamberlain et al. · 2012 [cited by applicant]
US 8394925B2 · Chamberlain et al. · 2013 [cited by applicant]
US 8475792B2 · Dall'Acqua et al. · 2013 [cited by applicant]
US 8546543B2 · Lazar · 2013 [cited by applicant]
US 8846042B2 · Zhou · 2014 [cited by applicant]
US 8911728B2 · Dimitrov et al. · 2014 [cited by applicant]
US 9587021B2 · Huang et al. · 2017 [cited by applicant]
US 9701759B2 · Desjarlais et al. · 2017 [cited by applicant]
US 9803023B2 · Chamberlain et al. · 2017 [cited by applicant]
US 9969809B2 · Kuo et al. · 2018 [cited by applicant]
US 10066016B2 · Dubridge et al. · 2018 [cited by applicant]
US 10131710B2 · Moore et al. · 2018 [cited by applicant]
US 10155815B2 · Bacac et al. · 2018 [cited by applicant]
US 10294300B2 · Raum et al. · 2019 [cited by applicant]
US 10882907B2 · Rehder et al. · 2021 [cited by applicant]
US 11597759B2 · Cihlar et al. · 2023 [cited by applicant]
US 20140302064A1 · Moore · 2014 [cited by applicant]
US 20150361160A1 · Burton et al. · 2015 [cited by applicant]
US 20200317779A1 · Kim et al. · 2020 [cited by applicant]
EP 0505908A1 · 1992 [cited by applicant]
JP H05219960A · 1993 [cited by applicant]
WO WO9404690A1 · 1994 [cited by applicant]
WO WO2011146891A2 · 2011 [cited by applicant]
WO WO2013163427A1 · 2013 [cited by applicant]
WO WO2014110601A1 · 2014 [cited by applicant]
WO WO2014159940A1 · 2014 [cited by applicant]
WO WO2015001085A1 · 2015 [cited by applicant]
WO WO2015063339A1 · 2015 [cited by applicant]
WO WO2015103549A1 · 2015 [cited by applicant]
WO WO2016014974A2 · 2016 [cited by applicant]
WO WO2016054023A1 · 2016 [cited by applicant]
WO WO2016054053A2 · 2016 [cited by applicant]
WO WO2016071004A1 · 2016 [cited by applicant]
WO WO2016153572A1 · 2016 [cited by applicant]
WO WO2016168758A1 · 2016 [cited by applicant]
WO WO2017074878A1 · 2017 [cited by applicant]
WO WO2017079272A2 · 2017 [cited by applicant]
WO WO2017106346A2 · 2017 [cited by applicant]
WO WO2017136659A2 · 2017 [cited by applicant]
WO WO2017157305A1 · 2017 [cited by applicant]
WO WO2018183139A1 · 2018 [cited by applicant]
WO WO2018191438A1 · 2018 [cited by applicant]
WO WO2018237148A1 · 2018 [cited by applicant]
WO WO2019034580A1 · 2019 [cited by applicant]
WO WO2019143636A1 · 2019 [cited by applicant]
WO WO2019183387A1 · 2019 [cited by applicant]
WO 2020047176 · 2020 [cited by applicant]
Dondelinger, M., et al., Oct. 2018, Understanding the Significance and Implications of Antibody Numbering and Antigen-Binding Surface/Residue Definition, Front. Immunol. 9(Article 2278), pp. 1-15. [cited by examiner]
Sela-Culang, I., et al., Oct. 2013, The structural basis of antibody-antigen recognition, Front. Immunol. 4(Article 302), pp. 1-13. [cited by examiner]
Chen W et al. (2014), “Exceptionally Potent and Broadly Cross-Reactive, Bispecific Multivalent HIV-1 Inhibitors Based on Single Human CD4 and Antibody Domains”, Journal of Virology, vol. 88, No. 2, p. 1125-1139. [cited by applicant]
Chen W et al. (2016), “Improving the CH1-CK heterodimerization and pharmacokinetics of 4Dm2m, a novel potent CD4-antibody fusion protein against HIV-1”, MABS, vol. 8, No. 4, p. 761-774. [cited by applicant]
Intl. Preliminary Report on Patentability—Written Opinion dated Mar. 9, 2023 for Intl. Appl. No. PCT/US2021/047165, 10 pages. [cited by applicant]
Intl. Search Report-Written Opinion dated Dec. 23, 2021 for Intl. Appl. No. PCT/US2021/047165, 18 pages. [cited by applicant]
Petrovas C et al. (2017), “Follicular CD8 T cells accumulate in HIV infection and can kill infected cells in vitro via bispecific antibodies”, Science Translational Medicine, vol. 9, No. 373, pp. 1-14. [cited by applicant]
Sloan D D et al. (2015), “Targeting HIV Reservoir in Infected CD4 T Cells by Dual-Affinity Re-targeting Molecules (DARTs) that Bind HIV Envelope and Recruit Cytotoxic T Cells”, PLOS Pathogens, vol. 11, No. 11, pp. 1-29. [cited by applicant]
Walker L M et al. (2011), “Broad neutralization coverage of HIV by multiple highly potent antibodies”, Nature, vol. 477, No. 7365, pp. 466-470. [cited by applicant]
Wu G et al. (2017), “HDAC inhibition induces HIV-1 protein and enables immune-based clearance following latency reversal”, JCI Insight, vol. 2, No. 16, pp. 1-11. [cited by applicant]
Office Action and Search Report dated May 30, 2023 for Taiwanese Appl. No. 110131303. [cited by applicant]
Examination Report dated Nov. 7, 2023 for European Appl. No. 21770379.2. [cited by applicant]
Pessano S et al. (1985), “The T3/T cell receptor complex: antigenic distinction between the two 20-kd T3 (T3-δ and T3-ε) subunits”, The EMBO Journal, vol. 4, No. 2, pp. 337-344. [cited by applicant]
Traunecker A et al. (1991), “Bispecific single chain molecules (Janusins) target cytotoxic lymphocytes on HIV infected cells”, The EMBO Journal, vol. 10, No. 12, pp. 3655-3659. [cited by applicant]
Brozy J et al. (2018), “Antiviral Activity of HIV gp120-Targeting Bispecific T Cell Engager Antibody Constructs”, Journal of Virology, vol. 92, Issue 14, e00491-18, pp. 1-13. [cited by applicant]
Li W et al. (2017), “One-domain CD4 Fused to Human Anti-CD16 Antibody Domain Mediates Effective Killing of HIV-1-Infected Cells”, Scientific Reports, vol. 7, 9130, pp. 1-12. [cited by applicant]
Office Action dated Mar. 1, 2024 for Japanese Appl. No. 2023-513114. [cited by applicant]
Notice of Allowance dated Jan. 29, 2024 for Taiwanese Appl. No. 110131303. [cited by applicant]
Examination Report dated Apr. 16, 2024 for European Appl. No. 21770379.2. [cited by applicant]
Office Action dated Apr. 23, 2024 for Egyptian Appl. No. 275/2023. [cited by applicant]
Capon D J et al. (1989), “Designing CD4 immunoadhesins for AIDS therapy”, Nature, 337(6207):525-31. [cited by applicant]
Chamow S M et al. (1992), “CD4 immunoadhesins in anti-HIV therapy: new developments”, Int J Cancer Suppl., 7:69-72. [cited by applicant]
Nordstrom J L et al. (2022), “Bispecific antibody-derived molecules to target persistent HIV infection”, J Virus Erad., 8(3):100083. [cited by applicant]
Office Action dated Jun. 28, 2024 for Euroasian Appl. No. 202390595. [cited by applicant]
Office Action and Search Report dated Aug. 8, 2024 fro Chilean Appl. No. 2023-00539. [cited by applicant]