Multi-specific antigen binding molecules targeting HIV and methods of use
Provided are multi-specific antigen binding molecules, including bispecific antibodies, that bind to CD3 and an HIV antigen, including HIV envelope protein gp120. Also provided are methods of using such antigen binding molecules to treat or prevent HIV infection.
1. A multi-specific antigen binding molecule that binds to human CD3 and an HIV antigen, wherein the antigen binding molecule comprises:
(a) a first antigen binding domain that comprises a first heavy chain variable domain (VH) and a first light chain variable domain (VL), wherein the first antigen binding domain binds to CD3 and comprises a first VH-complementarity determining region (CDR) 1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively:
(i) SEQ ID NOs: 1, 11, 8, 4, 9 and 10; or
(ii) SEQ ID NOs: 1, 12, 8, 4, 9 and 10,
wherein the first VH and the first VL comprise the amino acid sequences of SEQ ID NOs: 51 and 56, respectively, or comprise amino acid sequences that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs: 51 and 56; and
(b) the second antigen binding domain comprises one or more extracellular (EC) domains of CD4.
2. The multi-specific antigen binding molecule of claim 1 , wherein the one or more EC domains of CD4 comprise an amino acid sequence as set forth below, or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence selected from the group consisting of:
(i)
(SEQ ID NO: 746)
KKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTKGPSK
LNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLVVVG;
(ii)
(SEQ ID NO: 747)
KKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTKGPSK
LNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLVVVGG
GGSGKKVVYGKKGDTVELTCTASQKKNIQFHWKNSNQIKILGNQGSFLTK
GPSKLNDRVDSRRSLWDQGNFPLIIKNLKPEDSDTYICEVEDQKEEVQLV
VVG;
(iii)
(SEQ ID NO: 748)
KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK
LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFG;
or
(iv)
(SEQ ID NO: 749)
KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK
LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGG
GGSGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTK
GPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLL
VFG.
3. The multi-specific antigen binding molecule of claim 2 , wherein the EC domain of CD4 comprises an amino acid sequence of SEQ ID NO: 746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence of SEQ ID NO: 746.
4. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises a first VH-CDR1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively: SEQ ID NOs: 1, 11, 8, 4, 9 and 10; or SEQ ID NOs: 1, 12, 8, 4, 9 and 10; and the second antigen binding domain comprises one or more EC domains of CD4 comprising an amino acid sequence that comprises or is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domains of CD4 selected from the group consisting of SEQ ID NOs: 746-749.
5. The multi-specific antigen binding molecule of claim 4 , wherein the first antigen binding domain comprises a first VH-CDR1, a first VH-CDR2, a first VH-CDR3, a first VL-CDR1, a first VL-CDR2 and a first VL-CDR3 comprising the following amino acid sequences, respectively: SEQ ID NOs: 1, 12, 8, 4, 9 and 10; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO:746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domain of CD4 of SEQ ID NO: 746.
6. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises a first VH and a first VL comprising the amino acid sequences set forth, respectively, or comprising amino acid sequences that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs: 51 and 56; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO:746 or an amino acid sequence that is at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, identical to the EC domain of CD4 of SEQ ID NO: 746.
7. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1 or IgG4, comprising a first Fc region and a second Fc region.
8. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1 or IgG4, comprising a first Fc region and a second Fc region, comprising the following amino acids at the indicated positions (EU numbering):
(i) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R);
(ii) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), an arginine at position 435 (H435R) and a phenylalanine at position 436 (Y436F);
(iii) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), and a valine at position 407 (Y407V); and the second Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S) and a tryptophan at position 366 (T366W);
(iv) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a leucine at position 428 (M428L) and a serine at position 434 (N434S); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R); or
(v) the first Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a tyrosine at position 252 (M252Y), a threonine at position 254 (S254T) and a glutamic acid at position 256 (T256E); and the second Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R).
9. The multi-specific antigen binding molecule of claim 1 , comprising a heterodimeric human IgG1, comprising a first Fc region and a second Fc region, comprising the following amino acids at the indicated positions (EU numbering): the first Fc region comprises an alanine a position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a serine at position 366 (T366S), an alanine at position 368 (L368A), a valine at position 407 (Y407V), and an arginine at position 435 (H435R); and the second Fc region comprises an alanine at position 234 (L234A), an alanine at position 235 (L235A), a serine at position 331 (P331S), a tryptophan at position 366 (T366W), a tyrosine at position 252 (M252Y), a threonine at position 254 (S254T) and a glutamic acid at position 256 (T256E).
10. The multi-specific antigen binding molecule of claim 8 , comprising a heterodimeric human IgG1, comprising a first Fc region and a second Fc region, comprising amino acid sequences of SEQ ID NOs.: 703 and 705, or that are at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequences set forth, respectively: SEQ ID NOs.: 703 and 705.
11. The multi-specific antigen binding molecule of claim 1 , wherein the multi-specific antigen binding molecule is a bispecific antigen binding molecule.
12. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain has reduced or insignificant or substantially no binding to Protein A, or does not detectably bind to Protein A.
13. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to Protein A with a KD of greater than 10 −6 M.
14. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to CD3 with a KD of lower than 10 nM.
15. The multi-specific antigen binding molecule of claim 1 , wherein the antigen binding molecule has a serum half-life in a human or cynomolgus monkey of at least 3 days.
16. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain binds to CD3 with a K D of lower than 7.0 nM, and the antigen binding molecule has a serum half-life in a human or cynomolgus monkey of at least at least 5 days.
17. A pharmaceutical composition comprising one or more of the multi-specific antigen binding molecules claimed in claim 1 , and a pharmaceutically acceptable carrier.
18. A kit comprising one or more containers comprising one or more of the multi-specific antigen binding molecules claimed in claim 1 .
19. The multi-specific antigen binding molecule of claim 1 , wherein the first antigen binding domain comprises the first VH and the first VL comprising the amino acid sequences set forth, respectively, in SEQ ID NOs: 51 and 56.
20. The multi-specific antigen binding molecule of claim 2 , wherein the EC domain of CD4 comprises an amino acid sequence of SEQ ID NO: 746.
21. The multi-specific antigen binding molecule of claim 2 , wherein the first antigen binding domain comprises the first VH and the first VL comprising the amino acid sequences set forth, respectively, in SEQ ID NOs: 51 and 56; and the second antigen binding domain comprises the EC domain of CD4 comprising an amino acid sequence of SEQ ID NO: 746.