IP Library › Granted Patent US 12,195,534
Granted Patent B2
US 12,195,534 · App. 18/405,977 · Granted Jan 14, 2025

Binding molecules

Inventors: Nicole Mai (Abingdon, GB); Arnaud Techine (Abingdon, GB); Jakub Jaworski (Abingdon, GB); Kate Atkin (Abingdon, GB); Nathaniel Liddy (Abingdon, GB); Vijaykumar Karuppiah (Abingdon, GB); Ana Pereira Ribeiro (Abingdon, GB); Ana Penas (Abingdon, GB); Andrew Creese (Abingdon, GB); Emma Grant (Abingdon, GB); Stephen Harper (Abingdon, GB); Chandramouli Chillakuri (Abingdon, GB); Eduardo Mateos-Diaz (Abingdon, GB); Tamara Aleksic (Abingdon, GB); Pedro Cuadrado Rodenas (Abingdon, GB)
Assignee: IMMUNOCORE LIMITED
C07K16/2809A61P35/00C07K14/7051A61K38/00C07K2319/30
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,195,534
App. No.
18/405,977
Granted
Jan 14, 2025
Kind
B2
Abstract

The present invention relates to binding molecules that comprise T cell receptor (TCR) variable domains and which can bind to a PIWIL1 peptide-HLA complex. The invention also relates to the use of such molecules for the treatment of malignant diseases.

Claims (109)

1. A binding molecule comprising a TCR alpha chain variable a domain and a TCR beta chain variable domain, wherein the binding molecule has the property of binding to SLSNRLYYL (SEQ ID NO: 1) in complex with HLA-A*02, wherein each of the alpha chain variable domain and the beta chain variable domain comprises FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, where FR is a framework region and CDR is a complementarity determining region, comprising the following combination of alpha chain CDRs and beta chain CDRs:

Alpha

Beta

CDR1

CDR2

CDR3

CDR1

CDR2

CDR3

YIAANDF

GYKTN

LAWGGT

SGHGT

FHEEGV

ASSVDWV

(SEQ ID

(SEQ ID

DLLP

(SEQ ID

(SEQ ID

GDGERQY

NO: 23)

NO: 24)

(SEQ ID

NO: 37)

NO: 45)

(SEQ ID

NO: 29)

NO: 41).

2. The binding molecule of claim 1 , wherein the alpha chain variable domain framework regions comprise the following sequences:

FR1—LAKTTQPISMDSYEGQEVNITCSHN (SEQ ID NO: 8), or SEQ ID NO: 8 with one, two or three mutations therein,

FR2—ITWYQQFPSQGPRFIIQ (SEQ ID NO: 9), or SEQ ID NO: 9with one, two or three mutations therein,

FR3—VTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYC (SEQ ID NO: 10), or SEQ ID NO: 10 with one, two or three mutations therein,

FR4—FGTGTRLQVFP (SEQ ID NO: 11), or SEQ ID NO: 11 with one, two or three mutations therein,

and/or

the beta chain variable domain framework regions comprise the following sequences:

FR1—EAGVAQSPRYKIIEKRQSVAFWCNPI (SEQ ID NO: 18), or SEQ ID NO: 18 with one, two or three mutations therein,

FR2—LYWYQQILGQGPKLLIQ (SEQ ID NO: 19), or SEQ ID NO: 19 with one, two or three mutations therein,

FR3—VDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLC (SEQ ID NO: 20), or SEQ ID NO: 20 with one, two or three mutations therein,

FR4—FGPGTRLLVL (SEQ ID NO: 21), or SEQ ID NO: 21 with one, two or three mutations therein.

3. The binding molecule of claim 2 , wherein the alpha chain variable domain framework region comprises one or more of the following mutations:

L1

A

T21

P

I47

F

T56

Q

P65

S

numbered according to SEQ ID NO: 3.

4. The binding molecule of claim 3 , wherein the alpha chain variable domain framework region comprises one of the following combinations of mutations:

(a) I47F, T56Q

(b) L1A, I47F, T56Q

(c) T21P, I47F, T56Q, P65S

(d) L1A, T21P, I47F, T56Q, P65S

numbered according to SEQ ID NO: 3.

5. The binding molecule of claim 2 , wherein the beta chain variable domain framework region comprises the following mutation:

R16

G

numbered according to SEQ ID NO: 13.

6. The binding molecule of claim 1 , wherein the alpha chain variable domain comprises the amino acid sequence of SEQ ID NO: 34 and the beta chain variable domain comprises the amino acid sequence of SEQ ID NO: 48.

7. The binding molecule of claim 1 , comprises at least part of a TCR alpha chain constant domain and/or at least part of a TCR beta chain constant domain.

8. The binding molecule of claim 1 , is an alpha-beta heterodimer, having an alpha chain TRAC constant domain sequence and a beta chain TRBC1 or TRBC2 constant domain sequence.

9. The binding molecule of claim 8 , wherein a non-native covalent disulphide bond links a residue of the constant domain of the alpha chain to a residue of the constant domain of the beta chain.

10. The binding molecule of claim 1 , is in single chain format of the type V Vα-L-Vβ, Vβ-L-Vα, Vα-Cα-L-Vβ, or Vα-L-Vβ-Cβ, wherein Vα and Vβ are TCR α and β variable domains respectively, Cα and Cβ are TCR α and β constant domains respectively, and L is a linker sequence.

11. The binding molecule of claim 1 , comprises or consists of a TCR comprising the alpha chain variable domain and the beta chain variable domain.

12. The binding molecule of claim 1 , further comprising an immunoglobulin heavy chain variable domain (VH) and an immunoglobulin light chain variable domain (VL), which associate to form an antigen binding moiety site that is capable of binding to an antigen.

13. The binding molecule of claim 12 , wherein the antigen is a T cell surface antigen.

14. The binding molecule of claim 12 , wherein the antigen is CD3.

15. The binding molecule of claim 12 , wherein

(a) the VH comprises CDRs having the following sequences:

CDR1 -

(SEQ ID NO: 66)

GYSFTGYT   

or

(SEQ ID NO: 71)

GYSFTGYA;

CDR2 - 

(SEQ ID NO: 67)

INPYKGVS; 

and

CDR3 - 

(SEQ ID NO: 68

ARSGYYGDSDWYFDV,

and

(b) the VL comprises CDRs having the following sequences:

CDR1 -

(SEQ ID NO: 62)

QDIRNY;

CDR2 -

YTS;

and

CDR3 -

(SEQ ID NO: 64)

QQGNTLPWT.

16. The binding molecule of claim 15 , wherein

the VH comprises an amino acid sequence as set forth in SEQ ID NO: 65 or 69, or an amino acid sequence that has at least 90% identity, such as at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, to the amino acid sequence as set forth in SEQ ID NO: 65 or 69; and

the VL comprises an amino acid sequence as set forth in SEQ ID NO: 61, or an amino acid sequence that has at least 90% identity, such as at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, to the amino acid sequence as set forth in SEQ ID NO: 61.

17. The binding molecule of claim 12 , wherein the VH or VL is covalently linked to the C- or N-terminus of the alpha or beta chain of the TCR, or wherein the VH or VL is covalently linked to the C- or N-terminus of the alpha or beta chain of the TCR via a linker sequence, or wherein the VH or VL is covalently linked to the C- or N-terminus of the alpha or beta chain of the TCR via a linker sequence wherein the linker sequence is selected from SEQ ID NOs: 72 and 78-89.

18. The binding molecule of claim 1 , comprising an alpha chain amino acid sequence corresponding to SEQ ID NO: 58 and a beta chain-anti-CD3 amino acid sequence corresponding to SEQ ID NO: 77.

19. The binding molecule of claim 12 , comprising:

a first polypeptide chain which comprises the alpha chain variable domain and a first binding domain of a variable region of an antibody; and

a second polypeptide chain which comprises the beta chain variable domain and a second binding domain of a variable region of said antibody,

wherein the respective polypeptide chains associate such that the specific binding molecule is capable of simultaneously binding SLSNRLYYL (SEQ ID NO: 1) in complex with HLA-A*02 and an antigen of the antibody.

20. The binding molecule of claim 1 associated with an Fc domain.

21. A pharmaceutical composition comprising the binding molecule of claim 1 , together with one or more pharmaceutically acceptable carriers or excipients.

22. A method of treating cancer comprising administering the binding molecule of claim 1 or a pharmaceutical composition thereof.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 26, 2024
From: MAI, NICOLE; TECHINE, ARNAUD; JAWORSKI, JAKUB; ATKIN, KATE; LIDDY, NATHANIEL; KARUPPIAH, VIJAYKUMAR; PEREIRA RIBEIRO, ANA; PENAS, ANA; CREESE, ANDREW; GRANT, EMMA; HARPER, STEPHEN; CHILLAKURI, CHANDRAMOULI; MATEOS-DIAZ, EDUARDO; ALEKSIC, TAMARA; CUADRADO RODENAS, PEDRO
To: IMMUNOCORE LIMITED
Reel/Frame 066556/0423 →
Priority Claims (2)
GB 2300226 · Jan 6, 2023 · national
GB 2312621 · Aug 18, 2023 · national
Continuity (1)
Related Publication 20240254228A1 · Aug 1, 2024
References Cited (63)
US 20180346515A1 · Powlesland · 2018 [cited by examiner]
EP 2155783B1 · 2010 [cited by applicant]
WO 1998039482A1 · 1998 [cited by applicant]
WO 1999018129A1 · 1999 [cited by applicant]
WO 2000032039A1 · 2000 [cited by applicant]
WO 2001062908A2 · 2001 [cited by applicant]
WO 2003020763A2 · 2003 [cited by applicant]
WO 2004033685A1 · 2004 [cited by applicant]
WO 2010133828A1 · 2010 [cited by applicant]
WO 2014096803A1 · 2014 [cited by applicant]
WO 2015136072A1 · 2015 [cited by applicant]
WO 2017046198A1 · 2017 [cited by applicant]
WO 2017046201A1 · 2017 [cited by applicant]
WO 2017089771A1 · 2017 [cited by applicant]
WO 2019012138A1 · 2019 [cited by applicant]
WO 2019012141A1 · 2019 [cited by applicant]
WO 2020082130A1 · 2020 [cited by applicant]
WO 2020157210A1 · 2020 [cited by applicant]
WO 2021078774A1 · 2021 [cited by applicant]
WO 2022233957A1 · 2022 [cited by applicant]
WO 2022236050A1 · 2022 [cited by applicant]
Agirre et al., “The [cited by applicant]
Aleksic et al., “Different affinity windows for virus and cancer-specific T-cell receptors: implications for therapeutic strategies,” Eur J Immunol. 42(12):3174-9 (2012). [cited by applicant]
Atwell et al., “Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library,” J Mol Biol 270(1):26-35 (1997). [cited by applicant]
Bossi et al., “Examining the presentation of tumor-associated antigens on peptide-pulsed T2 cells,” Oncoimmunol. 1;2 (11) :e26840 (2013). [cited by applicant]
Boulter et al., “Stable, soluble T-cell receptor molecules for crystallization and therapeutics,” Protein Eng. 16, 707-711 (2003). [cited by applicant]
Bragado et al., “Allelic polymorphism in the coding region of human TCR Cα gene and characterization of structural variability in the a chain constant domain,” International Immunology 6(2):223-30 (1994). [cited by applicant]
Cameron et al., “Identification of a Titin-derived HLA-A1-presented peptide as a cross-reactive target for engineered MAGE A3-directed T cells,” Sci Transl. Med. 5 (197): 197ra103 (2013). [cited by applicant]
Dong et al., “Critical Roles of PIWIL1 in Human Tumors: Expression, Functions, Mechanisms, and Potential Clinical Implications,” Front. Cell Dev. Biol., 9:1-11, doi.org/10.3389/fcell.2021.656993 (2021). [cited by applicant]
Emsley et al., “Features and development of [cited by applicant]
Epel et al., “A functional recombinant single-chain T cell receptor fragment capable of selectively targeting antigen-presenting cells,” Cancer Immunol Immunother 51(10):565-73 (2002). [cited by applicant]
Gao, et al., “PIWI-like protein 1 upregulation promotes gastric cancer invasion and metastasis,” Onco Targets Ther. 11: 8783-8789. doi: 10.2147/OTT.S186827 (2018). [cited by applicant]
Garboczi et al., “HLA-A2-peptide complexes: Refolding and crystallization of molecules expressed in [cited by applicant]
Grochola et al., “The stem cell-associated Hiwi gene in human adenocarcinoma of the pancreas: expression and risk of tumour-related death,” Br J Cancer 99(7): 1083-8 (2008). [cited by applicant]
He et al., “Expression of HIWI in human esophageal squamous cell carcinoma is significantly associated with poorer prognosis,” BMC Cancer, 9:426 (2009). [cited by applicant]
Holler et al., “In vitro evolution of a T cell receptor with high affinity for peptide/MHC,” Proc. Natl. Acad. Sci. U S A. 97(10):5387-92 (2000). [cited by applicant]
Hoo et al., “Characterization of a single-chain T-cell receptor expressed in [cited by applicant]
Kabsch, “XDS,” Acta. Crystal. Sect D Biological Crystallogr. 66, 125-132 (2010). [cited by applicant]
Kovalevskiy et al., “Overview of refinement procedures within REFMAC5: utilizing data from different sources,” Acta. Crystal. Sect. D, Struct. Biol. 74, 215-227 (2018). [cited by applicant]
Li et al., “Directed evolution of human T-cell receptors with picomolar affinities by phage display,” Nat Biotechnol. 23(3):349-54 (2005). [cited by applicant]
Li et al., “The universal overexpression of a cancer testis antigen hiwi is associated with cancer angiogenesis,” Oncol Rep. 23(4):1063-1068 (2010). [cited by applicant]
Liddy et al., “Monoclonal TCR-redirected tumor cell killing,” Nat Med. 18(6):980-7 (2012). [cited by applicant]
Mareeva et al., “How a T Cell Receptor-like Antibody Recognizes Major Histocompatibility Complex-bound Peptide,” JBC 283(43):29053-29059 (2008). [cited by applicant]
McCoy et al., “ [cited by applicant]
Merchant et al., “An efficient route to human bispecific IgG,” Nat Biotechnol 16(7):677-81 (1998). [cited by applicant]
O'Callaghan et al., “BirA enzyme: production and application in the study of membrane receptor-ligand interactions by site-specific biotinylation,” Anal Biochem 266(1): 9-15 (1999). [cited by applicant]
Purbhoo et al., “Quantifying and Imaging NY-ESO-1/LAGE-1-Derived Epitopes on Tumor Cells Using High Affinity T Cell Receptors,” J Immunol 176(12): 7308-7316 (2006). [cited by applicant]
Ridgway et al., “‘Knobs-into-holes’ engineering of antibody CH3 domains for heavy chain heterodimerization,” Prot Engineering 9:617 (1996). [cited by applicant]
Rudolph et al., “How TCRs bind MHCs, peptides, and coreceptors,” Annu Rev Immunol. 24, 419-466 (2006). [cited by applicant]
Schodin et al., Mol Immunol 33(9): 819-829 (1996). [cited by applicant]
Shearman et al., “Construction, expression and characterization of humanized antibodies directed against the human alpha/beta T cell receptor,” J Immunol. 147, 4366-73 (1991). [cited by applicant]
Taubert et al., “Expression of the stem cell self-renewal gene Hiwi and risk of tumourrelated death in patients with soft-tissue sarcoma,” Oncogene. 26(7):1098-100 (2007). [cited by applicant]
Vonrhein et al., “Data processing and analysis with the [cited by applicant]
Weidanz et al., “Display of functional αβ single-chain T-cell receptor molecules on the surface of bacteriophage,” J Immunol Methods. 221(1-2):59-76 (1998). [cited by applicant]
Willuda et al., “Tumor Targeting of Mono-, Di-, and Tetravalent Anti-p185 [cited by applicant]
Wilson et al., “Specificity and degeneracy of T cells ,” Mol Immunol. 40(14-15):1047-55 (2004). [cited by applicant]
Winter et al., “DIALS: Implementation and evaluation of a new integration package,” Acta. Cryst. Sect D Struct Biology. 74, 85-97 (2018). [cited by applicant]
Winter, “xia2: an expert system for macromolecular crystallography data reduction,” J Appl. Crystal. 43, 186-190 (2010). [cited by applicant]
Wooldridge et al., “A single autoimmune T cell receptor recognizes more than a million different peptides,” J Biol Chem. 287(2):1168-77 (2012). [cited by applicant]
Zeng et al., “HIWI expression profile in cancer cells and its prognostic value for patients with colorectal cancer,” Chin Med J (Engl). 124(14):2144-9 (2011). [cited by applicant]
Zhao et al., “High-affinity TCRs generated by phage display provide CD4+ T cells with the ability to recognize and kill tumor cell lines,” J Immunol. 179(9):5845-54 (2007). [cited by applicant]
Zhu et al., “Identification of heavy chain residues in a humanized anti-CD3 antibody important for efficient antigen binding and T cell activation,” J Immunol. 155, 1903-1910 (1995). [cited by applicant]
International Search Report in PCT/EP2024/050194, dated Mar. 20, 2024. [cited by applicant]
Cited By (1)
US 12,590,152