IP Library Granted Patent US 12,338,470
Granted Patent B2
US 12,338,470 · App. 18/298,995 · Granted Jun 24, 2025

Enzymes and systems for synthesizing DNA

Inventors: Paul F. Predki (Carlsbad, CA); Stefen Boehme (Encinitas, CA)
Assignee: IRIDIA, INC.
C12N9/90B01L3/508C12N15/74C12P19/34C12Y599/01002B01L2300/047
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,338,470
App. No.
18/298,995
Granted
Jun 24, 2025
Kind
B2
Abstract

The disclosure provides novel topoisomerases which exhibit weakened ability to form a covalent bond to the 5′-(C/T)CCTT-3′recognition site in the presence of increased NaCl concentrations relative to wild-type, together with novel methods for synthesizing DNA in the 3′ to 5′ direction using the novel topoisomerase; and other compounds, compositions, methods and devices comprising or utilizing topoisomerases which exhibit reduced covalent bond formation to the 5′-(C/T)CCTT-3′ recognition site in the presence of increased NaCl concentrations, relative to wild-type.

Claims (18)

1. A topoisomerase comprising the following sequence:

SEQ ID NO: 3

RALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWE

EALTRLIFVGSDSKGX 1 RX 2 X 3 FYGKMHVQNX 4 NAKRDRIFVRVYNVMKR

INCFINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLT

LKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEE

FLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPS

PKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTF

DEFLSIVVDHVKSSTDG

wherein at least two of X 1 , X 2 , X 3 , and X 4 , are mutated from the residues in the wild type sequence [wherein in the wild-type sequence, X 1 is arginine (R), X 2 is glutamine (Q), X 3 is tyrosine (Y), and X 4 is arginine (R)] to glycine (G), alanine (A) or valine (V);

provided that where only two residues are mutated, X 1 and X 2 are not both mutated to A.

2. The topoisomerase of claim 1 wherein at least three or all of four of X 1 , X 2 , X 3 , and X 4 are mutated to A.

3. The topoisomerase of claim 1 wherein

X 2 and X 4 are A; or

X 1 , X 2 , and X 4 are A; or

X 1 , X 3 , and X 4 are A.

4. The topoisomerase of claim 1 which comprises one or more isolation sequences.

5. The topoisomerase of claim 1 which comprises SEQ ID NO: 4.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jun 29, 2023
From: BOEHME, STEFEN; PREDKI, PAUL F.
To: IRIDIA, INC.
Reel/Frame 064114/0259 →
Continuity (3)
Division 16866439 · May 4, 2020
Provisional Application 62842333 · May 2, 2019
Related Publication 20240084284A1 · Mar 14, 2024
References Cited (51)
US 8153590B2 · Lu et al. · 2012 [cited by applicant]
US 8202689B2 · Heller et al. · 2012 [cited by applicant]
US 8283165B2 · Hogan et al. · 2012 [cited by applicant]
US 8512947B2 · Mutharasan et al. · 2013 [cited by applicant]
US 9322820B2 · Blick et al. · 2016 [cited by applicant]
US 9488600B2 · Blick et al. · 2016 [cited by applicant]
US 9551697B2 · Chen · 2017 [cited by applicant]
US 10196680B2 · Sharaf et al. · 2019 [cited by applicant]
US 10438662B2 · Predki · 2019 [cited by applicant]
US 10443096B2 · Ju et al. · 2019 [cited by applicant]
US 10640822B2 · Predki et al. · 2020 [cited by applicant]
US 10714178B2 · Predki et al. · 2020 [cited by applicant]
US 10859562B2 · Predki et al. · 2020 [cited by applicant]
US 10995373B2 · Predki et al. · 2021 [cited by applicant]
US 11505825B2 · Predki · 2022 [cited by applicant]
US 11655465B1 · Predki et al. · 2023 [cited by applicant]
US 20010026918A1 · Collins et al. · 2001 [cited by applicant]
US 20050053968A1 · Bharadwaj et al. · 2005 [cited by applicant]
US 20090098119A1 · Lu et al. · 2009 [cited by applicant]
US 20090203000A1 · Mutharasan et al. · 2009 [cited by applicant]
US 20090221443A1 · Heller et al. · 2009 [cited by applicant]
US 20120058468A1 · McKeown · 2012 [cited by applicant]
US 20120322109A1 · Shuman et al. · 2012 [cited by applicant]
US 20120326732A1 · Cho et al. · 2012 [cited by applicant]
US 20130264207A1 · Ju et al. · 2013 [cited by applicant]
US 20140266147A1 · Blick et al. · 2014 [cited by applicant]
US 20150107996A1 · Chen · 2015 [cited by applicant]
US 20160025655A1 · Blick et al. · 2016 [cited by applicant]
US 20160223538A1 · Mcalpine et al. · 2016 [cited by applicant]
US 20170275678A1 · Sharaf et al. · 2017 [cited by applicant]
US 20190080760A1 · Predki et al. · 2019 [cited by applicant]
US 20190136307A1 · Predki et al. · 2019 [cited by applicant]
US 20190341108A1 · Predki et al. · 2019 [cited by applicant]
US 20190383788A1 · Predki et al. · 2019 [cited by applicant]
US 20200224264A1 · Predki et al. · 2020 [cited by applicant]
WO WO2017151680 · 2017 [cited by applicant]
WO WO2018081745 · 2018 [cited by applicant]
WO WO2019213437 · 2019 [cited by applicant]
WO WO2020051501A1 · 2020 [cited by applicant]
Benner S., et al., “Sequence-specific detection of individual DNA polymerase complexes in real time using a nanopore,” Nature Nanotechnology, 2007, 2(11):718-724. [cited by applicant]
International Search Report of International Application No. PCT/US2017/020044, prepared by the International Searching Authority, date mailed: Aug. 16, 2017, 4 pages. [cited by applicant]
International Search Report of International Application No. PCT/US2017/059100, prepared by the International Searching Authority, date mailed: Jan. 18, 2018, 3 pages. [cited by applicant]
International Search Report of International Application No. PCT/US2019/030463, prepared by the International Searching Authority, date mailed: Aug. 30, 2019, 5 pages. [cited by applicant]
Manrao E., et al., “Reading DNA at single-nucleotide resolution with a mutant MspA nanopore and phi29 DNA polymerase,” Nature Biotechnology, 2012, 30(4):349-354. [cited by applicant]
Minkah N., et al., “Variola Virus Topoisomerase: DNA Cleavage Specificity and Distribution of Sites in Poxvirus Genomes,” Virology, 2007, 365(1):60-69. [cited by applicant]
Palaniyar N., et al., “SFV topoisomerase: sequence specificity in a genetically mapped interval,” Virology, 1996, 221(2):351-4. [cited by applicant]
Reed et al., “Characterization of DNA Binding by the Isolated N-Terminal Domain of Vaccinia Virus DNA Topoisomerase IB,” Biochemistry, 2017, 56:3307-3317. [cited by applicant]
Shuman S., “Novel Approach to Molecular Cloning and Polynucleotide Synthesis Using Vaccinia DNA Topoisomerase*,” J Biol Chem., 1994, 269(51):32678-84. [cited by applicant]
Shuman S., “Vaccinia virus DNA topoisomerase: a model eukaryotic type IB enzyme,” Biochimica et Biophysica Acta, 1998, 1400:321-337. [cited by applicant]
Stivers J.T., et al., “Vaccinia DNA Topoisomerase I: Single-Turnover and Steady-State Kinetic Analysis of the DNA Strand Cleavage and Ligation Reactions,” Biochemistry, 1994, 33(1):327-339. [cited by applicant]
Tian et al., “Individual Nucleotide Bases, Not Base Pairs, Are Critical for Triggering Site-specific DNA Cleavage by Vaccinia Topoisomerase,” The Journal of Biological Chemistry, 2004, 279(38):39718-39726. [cited by applicant]