IP Library › Granted Patent US 12,391,746
Granted Patent B2
US 12,391,746 · App. 16/971,627 · Granted Aug 19, 2025

HPV proteins, antibodies, and uses in managing abnormal epithelial cell growth

Inventors: Andreas Wieland (Atlanta, GA); Rafi Ahmed (Atlanta, GA)
Assignee: Emory University
C07K16/084A61K38/2013A61K39/3955A61K40/11A61K40/31A61K40/46C12N5/0636C07K2317/24C12N2510/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,391,746
App. No.
16/971,627
Granted
Aug 19, 2025
Kind
B2
Abstract

This disclosure relates to HPV proteins, antibodies, and uses in managing abnormal epithelial cell growth. In certain embodiments, this disclosure relates to detecting an HPV protein in a sample and correlating the presence as an indication that a subject is at risk of developing an HPV-related disease or condition. In certain embodiments, the HPV protein is E2 and/or E6. In certain embodiments, this disclosure relates to vaccinating or treating a subject for an HPV infection or related condition optionally in combination with immune-checkpoint inhibitors. In certain embodiments, this disclosure relates to HPV protein specific antibodies and binding agents for uses reported herein.

Claims (70)

1. A chimeric antibody that specifically binds HPV16 E2 protein wherein the antibody comprises a light chain and a heavy chain,

wherein the light chain CDR1 is GYTFTSYP (SEQ ID NO: 67), CDR2 is INTNNGNP (SEQ ID NO: 68), and CDR3 is ARAGFEIYGDAFTYYGMDV (SEQ ID NO: 69); and

wherein the heavy chain CDR1 is TGDIGAYKF (SEQ ID NO: 72), CDR2 is EVSN (SEQ ID NO: 73), and CDR3 is SSYRGNTTL (SEQ ID NO: 74).

2. The chimeric antibody of claim 1 , wherein the light chain comprises the amino acid sequence of

(SEQ ID NO: 71)

MAWALLLLTLLTQGTGSWAQSALTQPASVSGSPGQLITISCIGSTGDIG

AYKFVSWYQQYPGKAPKLMIYEVSNRPSGISSRFSGSKSGNTASLTISG

LQVDDEADYYCSSYRGNTTLFGGGTKLTVLG.

3. The chimeric antibody of claim 1 , wherein the heavy chain comprises the amino acid sequence of

(SEQ ID NO: 66)

MDWTWRILFLVAAATGVHSQMQLEQSGSELKKPGASVKVSCKASGYTFT

SYPMNWVRQAPGQGLEWMGWINTNNGNPTYARDFTGRFVFSLDASVNTA

HLQITSLEAEDTAVYYCARAGFEIYGDAFTYYGMDVWGQGTTVTVSS.

4. The chimeric antibody of claim 1 , wherein the heavy chain comprises one or more of the following Fc mutations G236A, S239D, A330L, I332E, S267E, L328F, P238D, H268F, S324T, S228P, G236R, L328R, L234A, L235A, M252Y, S254T, T256E, M428L, and N434S

wherein the Fc mutations are in reference to following amino acid sequence starting at amino acid 119:

(SEQ ID NO: 179)

STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL

NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV

DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG.

5. A chimeric antibody that specifically binds HPV16 E2 protein wherein the antibody comprises a light chain and a heavy chain,

wherein the light chain CDR1 is SGRTTFA (SEQ ID NO: 62), CDR2 is IYNDGSH (SEQ ID NO: 63), and CDR3 is QTWGSGSVM (SEQ ID NO: 64); and

wherein the heavy chain CDR1 is GFTFTNYA (SEQ ID NO: 57), CDR2 is ITDNADAT (SEQ ID NO: 58), and CDR3 is AKHHHRDDAFDV (SEQ ID NO: 59).

6. The chimeric antibody of claim 5 , wherein the light chain comprises the amino acid sequence of

(SEQ ID NO: 61)

MAWTPLLFLTLLLHCTGSLSQPVVTQSPSASASLGASVRLTCTLSSGRT

TFAVAWHQQQPQKAPRFLMRIYNDGSHFKGAGIPDRFSGSSSGAERYLT

ISSLQSDDEADYYCQTWGSGSVMFGGGTKVTVLG.

7. The chimeric antibody of claim 5 , wherein the heavy chain comprises the amino acid sequence of

(SEQ ID NO: 56)

MVIRTEQRELTMEFGLNWLFLVAILKGVQCEAQLFQSGGGLVQPGGSLR

LTCATSGFTFTNYALSWVRQAPGRGLEWVSSITDNADATYYADSVRGRF

TISRDNPKNTLYLQMDSLTAHDTAIYFCAKHHHRDDAFDVWGQGTMITV

SS.

8. The chimeric antibody of claim 5 , wherein the heavy chain comprises one or more of the following Fc mutations G236A, S239D, A330L, I332E, S267E, L328F, P238D, H268F, S324T, S228P, G236R, L328R, L234A, L235A, M252Y, S254T, T256E, M428L, and N434S

wherein the Fc mutations are in reference to following amino acid sequence starting at amino acid 119:

(SEQ ID NO: 179)

STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL

NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV

DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG.

9. A chimeric antibody that specifically binds HPV16 E2 protein wherein the antibody comprises a light chain and a heavy chain,

wherein the light chain CDR1 is VLPKKY (SEQ ID NO: 176), CDR2 is EDTK (SEQ ID NO: 177), and CDR3 is YSTDSSGNF (SEQ ID NO: 178); and

wherein the heavy chain CDR1 is GYDFAKYY (SEQ ID NO: 134), CDR2 is INPQNGVT (SEQ ID NO: 135), and CDR3 is NILYISGSNVWDY (SEQ ID NO: 136).

10. The chimeric antibody of claim 9 , wherein the light chain comprises the amino acid sequence of

(SEQ ID NO: 138)

MAWTPLLLPLLTFCTVSEASSELTQPPSVSVSPGQTARITCSGDVLPKK

YAYWYQQKSGQAPVLVVYEDTKRPSGIPERFSGSSSGTMATLTISGAQV

GDEGDYYCYSTDSSGNFFGGGTKLTVLG.

11. The chimeric antibody of claim 9 , wherein the heavy chain comprises the amino acid sequence of

(SEQ ID NO: 133)

MDWTWRVFCLLAVAPGAHSQVQMVQSGTEVKKPGASVKVSCKASGYDFA

KYYISWVRQAPGQGLEWMGMINPQNGVTTYTQKVQGRVTLTRDTSTTTV

YMELSSLRFEDTAVYYCNILYISGSNVWDYWGQGTLVTVSS.

12. The chimeric antibody of claim 9 , wherein the heavy chain comprises one or more of the following Fc mutations G236A, S239D, A330L, I332E, S267E, L328F, P238D, H268F, S324T, S228P, G236R, L328R, L234A, L235A, M252Y, S254T, T256E, M428L, and N434S

wherein the Fc mutations are in reference to following amino acid sequence starting at amino acid 119:

(SEQ ID NO: 179)

STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL

NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV

DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG.

Continuity (2)
Provisional Application 62632777 · Feb 20, 2018
Related Publication 20200399348A1 · Dec 24, 2020
References Cited (26)
US 8420103B2 · Baudin · 2013 [cited by applicant]
US 20010034021A1 · Muller · 2001 [cited by applicant]
US 20040152074A1 · Muller · 2004 [cited by applicant]
US 20050226875A1 · Gomez-Navarro · 2005 [cited by applicant]
US 20090269732A1 · Ivey · 2009 [cited by applicant]
US 20090312527A1 · Cheng · 2009 [cited by applicant]
US 20100151466A1 · Schlegel · 2010 [cited by applicant]
US 20150153345A1 · Dixon · 2015 [cited by applicant]
US 20150218264A1 · Cattaneo · 2015 [cited by applicant]
US 20170007693A1 · Weiner · 2017 [cited by applicant]
US 20170028052A1 · Ramos · 2017 [cited by applicant]
US 20170247456A1 · Freeman · 2017 [cited by applicant]
US 20170281747A1 · Bunnik · 2017 [cited by applicant]
GB 2379220 · 2003 [cited by applicant]
WO 2015149051 · 2015 [cited by applicant]
Liu et al (Fc-Engineering for Modulated Effector Functions-Improving Antibodies for Cancer Treatment. Antibodies (Basel). Nov. 17, 2020;9(4):64) (Year: 2020). [cited by examiner]
Hezareh et al ( Effector function activities of a panel of mutants of a broadly neutralizing antibody against human immunodeficiency virus type 1. J Virol. Dec. 2001;75(24):12161-8) (Year: 2001). [cited by examiner]
Rosales et al (Antibodies against human papillomavirus (HPV) type 16 and 18 E2, E6 and E7 proteins in sera: correlation with presence of papillomavirus DNA. J Med Virol. Dec. 2001;65(4):736-44) (Year: 2001). [cited by examiner]
McCarthy et al. (J. Immunol. Methods, 251(1-2): 137-149, 2001) (Year: 2001). [cited by examiner]
Lin et al. (African Journal of Biotechnology, 10(79):18294-18302, 2011) (Year: 2011). [cited by examiner]
Bechtold et al. Human Papillomavirus Type 16 E2 Protein Has No. Effect on Transcription from Episomal Viral DNA, Journal of Virology, 2003, 77(3):2021-2028. [cited by applicant]
Eberhardt et al. Functional HPV-specific PD-1+ stem-like CD8 T cells in head and neck cancer, Nature, 2021, 597(7875):279-284. [cited by applicant]
Paolini et al. Human papillomavirus 16 E2 interacts with neuregulin receptor degradation protein 1 affecting ErbB-3 expression in vitro and in clinical samples of cervical lesions, European Journal of Cancer 58 (2016) 5… [cited by applicant]
Ruttkay-Nedecky et al. I Relevance of infection with human papillomavirus: The role of the p53 tumor suppressor protein and E6/E7 zinc finger proteins (Review), International Journal of Oncology 43: 1754-1762, 2013. [cited by applicant]
Thomas et al. Human papillomaviruses, cervical cancer and cell polarity, Oncogene, 2008, 27, 7018-7030. [cited by applicant]
Wieland et al. Defining HPV-specific B cell responses in patients with head and neck cancer, Nature, Sep. 2021;597(7875):274-278. [cited by applicant]