Compound having affinity substance to antibody, cleavable portion, and reactive group, or salt thereof
Compounds having an affinity substance to an antibody, a cleavable portion, and a reactive group, or a salt thereof, are represented by the following Formula (I): A-L-B—R (I) wherein A is an affinity substance to an antibody, L is a cleavable linker that is a divalent group comprising a cleavable portion, B is (a) a divalent group comprising a bioorthogonal functional group or (b) a divalent group comprising no bioorthogonal functional group, and R is a reactive group to the antibody, wherein the affinity substance to an antibody is a polypeptide comprising a glutamine residue (Q) at an N-terminal.
1. A compound having an affinity substance to an antibody, a cleavable portion, and a reactive group, or a salt thereof, the compound being represented by the following Formula (I):
A-L-B—R (I),
wherein
A is the affinity substance to an antibody,
L is a cleavable linker that is a divalent group comprising the cleavable portion,
B is (a) a divalent group comprising a bioorthogonal functional group or (b) a divalent group comprising no bioorthogonal functional group, wherein the bioorthogonal functional group has a chemical structure selected from the group consisting of the following:
wherein
R 1f , one or a plurality of R 1g s, and one or a plurality of R 1h s are the same as or different from each other, and are each an atom or a group selected from the group consisting of the substituent (i) to (vii) or an electron-withdrawing group, and
● is a bond,
wherein the substituent (i) to (vii) are:
(i) a halogen atom;
(ii) a monovalent hydrocarbon group;
(iii) an aralkyl;
(iv) a monovalent heterocyclic group;
(v) R c —O—, R c —C(═O)—, R c —O—C(═O)—, or R c —C(═O)—O—, wherein R c represents a hydrogen atom or a monovalent hydrocarbon group;
(vi) NR d R e —, NR d R e —C(═O)—, NR d R e —C(═O)—O—, or R d —C(═O)—NR e —, wherein R d and R e are the same as or different from each other, and each represent a hydrogen atom or a monovalent hydrocarbon group; or
(vii) a nitro group, a sulfate group, a sulfonate group, a cyano group, or a carboxyl group, and
R is the reactive group to the antibody,
wherein the affinity substance to an antibody is a polypeptide comprising a glutamine residue (Q) at an N-terminal terminal and is selected from the group consisting of the following (1) to (4):
wherein Q is a glutamine residue at an N-terminal, E is a glutamic acid residue, T is a threonine residue, the solid line is a bond, the spacer portion consists of 1 to 50 amino acid residues, and the antibody-affinity polypeptide portion consists of 15 to 70 amino acid residues, wherein the antibody-affinity polypeptide portion is selected from the group consisting of protein A, protein G, protein L, protein Z, and a fragment thereof having affinity to an antibody, and a variant thereof having affinity to an antibody.
2. The compound or salt thereof according to claim 1 , wherein the glutamine residue is pyroglutamylated.
3. The compound or salt thereof according to claim 1 , wherein the antibody-affinity polypeptide portion comprises an amino acid sequence with any one amino acid residue substituted with a lysine residue in the amino acid sequence of FNMQCQRRFYEALHDPNLNEEQRNAXIXSIRDDC (SEQ ID NO: 5) and having at least 90% identity to the amino acid sequence of SEQ ID NO: 5, and
wherein two Xs are each independently one amino acid residue selected from the group consisting of an arginine residue, a glutamic acid residue, and a glutamine residue.
4. The compound or salt thereof according to claim 1 , wherein the antibody-affinity polypeptide portion comprises an amino acid sequence with any one amino acid residue substituted with a lysine residue in the amino acid sequence of FNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO: 6) and having at least 90% identity to the amino acid sequence of SEQ ID NO: 6.
5. The compound or salt thereof according to claim 1 , wherein the affinity substance to an antibody comprises an amino acid sequence selected from the group consisting of the following:
(1)
(SEQ ID NO: 7)
QETNPTENLYFQQKNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC;
(2)
(SEQ ID NO: 8)
QTADNQKNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDCSQSANLLAE
AQQLNDAQAPQA;
(3)
(SEQ ID NO: 9)
QETKNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC;
(4)
(SEQ ID NO: 10)
QETFNKQCQRRFYEALHDPNLNEEQRNARIRSIRDDC;
(5)
(SEQ ID NO: 22)
QETENMQCQRRFYEALHDPNLNKEQRNARIRSIRDDC;
(6)
(SEQ ID NO: 23)
QETENMQCQRRFYEALHDPNLNEEQRNARIRSIKDDC;
(7)
(SEQ ID NO: 51)
QETMQCQRRFYEALHDPNLNEEQRNARIRSIKDDC;
(8)
(SEQ ID NO: 52)
QETQCQRRFYEALHDPNLNEEQRNARIRSIKDDC;
(9)
(SEQ ID NO: 53)
QETCQRRFYEALHDPNLNEEQRNARIRSIKDDC;
(10)
(SEQ ID NO: 24)
QETRGNCAYHKGQLVWCTYH; and
(11)
(SEQ ID NO: 25)
QETRGNCAYHKGQIIWCTYH.
6. A reagent of regioselectively modifying an antibody, the reagent comprising a compound having an affinity substance to an antibody, a cleavable portion, and a reactive group, or a salt thereof, the compound being represented by the following Formula (I):
A-L-B—R (I),
wherein
A is the affinity substance to an antibody,
L is a cleavable linker that is a divalent group comprising the cleavable portion,
B is (a) a divalent group comprising a bioorthogonal functional group or (b) a divalent group comprising no bioorthogonal functional group, wherein the bioorthogonal functional group corresponds to any one chemical structure selected from the group consisting of the following:
wherein
R 1f , one or a plurality of R 1g s, and one or a plurality of R 1h s are the same as or different from each other, and are each an atom or a group selected from the group consisting of the substituent (i) to (vii) or an electron-withdrawing group, and
● is a bond,
wherein the substituent (i) to (vii) are:
(i) a halogen atom;
(ii) a monovalent hydrocarbon group;
(iii) an aralkyl;
(iv) a monovalent heterocyclic group;
(v) R c —O—, R c —C(═O)—, R c —O—C(═O)—, or R c —C(═O)—O—, wherein R c represents a hydrogen atom or a monovalent hydrocarbon group;
(vi) NR d R e —, NR d R e —C(═O)—, NR d R e —C(═O)—O—, or R d —C(═O)—NR e —, wherein R d and R e are the same as or different from each other, and each represent a hydrogen atom or a monovalent hydrocarbon group; or
(vii) a nitro group, a sulfate group, a sulfonate group, a cyano group, or a carboxyl group, and
R is the reactive group to the antibody,
wherein the affinity substance to an antibody is a polypeptide comprising a glutamine residue (Q) at an N-terminal, and is selected from the group consisting of the following (1) to (4):
wherein Q is a glutamine residue at an N-terminal, E is a glutamic acid residue, T is a threonine residue, the solid line is a bond, the spacer portion consists of 1 to 50 amino acid residues, and the antibody-affinity polypeptide portion consists of 15 to 70 amino acid residues, wherein the antibody-affinity polypeptide portion is selected from the group consisting of protein A, protein G, protein L, protein Z, and a fragment thereof having affinity to an antibody, and a variant thereof having affinity to an antibody.