IP Library › Granted Patent US 12,522,667
Granted Patent B2
US 12,522,667 · App. 17/510,099 · Granted Jan 13, 2026

Chimeric antigen receptors (CARs) having mutations in the fc spacer region and methods for their use

Inventors: Stephen J. Forman (Duarte, CA); Christine E. Brown (Duarte, CA); Armen Mardiros (Glendale, CA)
Assignee: City of Hope
C07K16/30A61K39/39558A61K40/11A61K40/31A61K40/4211A61K45/06C07K14/7051C07K14/70517C07K14/70521C07K14/71C07K16/00C07K16/2803C07K16/2866A61K2239/17A61K2239/31A61K2239/38C07K2317/524C07K2317/526C07K2317/53C07K2317/56C07K2317/622C07K2317/92C07K2319/00C07K2319/02C07K2319/03C07K2319/30C07K2319/33
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,522,667
App. No.
17/510,099
Granted
Jan 13, 2026
Kind
B2
Abstract

Chimeric antigen receptors that include an antigen recognition domain; a spacer domain derived from a modified immunoglobulin Fc region having one or more mutations in its CH2 region resulting in impaired binding to an FcR; and an intracellular signaling domain.

Claims (11)

1 . A recombinant chimeric antigen receptor (CAR) comprising:

an antigen recognition domain that targets a cancer associated antigen selected from the group consisting of CD19, CD20, CD123, HER2, IL-13 receptor α2, prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), and tumor-associated glycoprotein-72 (TAG-72);

a spacer domain comprising the amino acid sequence ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT KPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA LHNHYTQKSLSLSLGK (SEQ ID NO: 19);

a transmembrane domain;

a co-stimulatory intracellular signaling domain selected from the group consisting of: CD28, ICOS, OX40, CD27, DAP10, 4-1BB, p56lck, and 2B4; and

a T cell receptor (TCR) zeta chain signaling domain.

2 . The chimeric antigen receptor of claim 1 , wherein the co-stimulatory intracellular signaling domain is 4-1BB.

3 . The chimeric antigen receptor of claim 1 , wherein the co-stimulatory intracellular signaling domain is CD28.

4 . The chimeric antigen receptor of claim 1 , wherein the antigen recognition domain targets IL-13 receptor α2.

5 . The chimeric antigen receptor of claim 1 , wherein the antigen recognition domain is an scFv.

6 . The chimeric antigen receptor of claim 5 , wherein the antigen recognition domain is an scFv that targets CD19 and comprises a light chain variable domain comprising the amino acid sequence of SEQ ID NO:1 and a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2.

Assignments (2)
CONFIRMATORY LICENSE Recorded Jan 4, 2024
From: BECKMAN RESEARCH INSTITUTE/CITY OF HOPE
To: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT
Reel/Frame 066204/0878 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Oct 26, 2021
From: FORMAN, STEPHEN J.; BROWN, CHRISTINE E.; JONNALAGADDA, UMA MAHESWARA RAO; MARDIROS, ARMEN
To: CITY OF HOPE
Reel/Frame 057910/0858 →
Continuity (4)
Continuation 16221257 · Dec 14, 2018
Continuation 15111384
Provisional Application 61926881 · Jan 13, 2014
Related Publication 20220372164A1 · Nov 24, 2022
References Cited (157)
US 7070995B2 · Jensen · 2006 [cited by applicant]
US 9657105B2 · Forman · 2017 [cited by examiner]
US 9914909B2 · Brown et al. · 2018 [cited by applicant]
US 10660916B2 · Forman et al. · 2020 [cited by applicant]
US 10676717B2 · Brown et al. · 2020 [cited by applicant]
US 11918606B2 · Forman et al. · 2024 [cited by applicant]
US 20020102264A1 · Cheung · 2002 [cited by applicant]
US 20090252742A1 · Bergstein · 2009 [cited by applicant]
US 20120148552A1 · Jensen · 2012 [cited by applicant]
US 20120301447A1 · Jensen · 2012 [cited by applicant]
US 20130004514A1 · Zahn · 2013 [cited by applicant]
US 20130287798A1 · Cheung · 2013 [cited by applicant]
US 20130295116A1 · Zahn et al. · 2013 [cited by applicant]
US 20140271582A1 · Forman et al. · 2014 [cited by applicant]
US 20140271635A1 · Brogdon et al. · 2014 [cited by applicant]
US 20140322212A1 · Brogdon · 2014 [cited by applicant]
US 20150024482A1 · Frigault et al. · 2015 [cited by applicant]
US 20160333108A1 · Forman et al. · 2016 [cited by applicant]
US 20170260277A1 · Forman et al. · 2017 [cited by applicant]
US 20200040096A1 · Forman et al. · 2020 [cited by applicant]
US 20200254023A1 · Forman et al. · 2020 [cited by applicant]
CN 101952454 · 2011 [cited by applicant]
CN 103492406 · 2014 [cited by applicant]
CN 105392887 · 2016 [cited by applicant]
EA 009873 · 2008 [cited by applicant]
JP 2011514150 · 2011 [cited by applicant]
JP 2012501180 · 2012 [cited by applicant]
JP 2016514457 · 2016 [cited by applicant]
WO WO2005076843 · 2005 [cited by applicant]
WO WO2009100309 · 2009 [cited by applicant]
WO WO2010025177 · 2010 [cited by applicant]
WO WO2010085682 · 2010 [cited by applicant]
WO WO2011056894 · 2011 [cited by applicant]
WO WO2012031744 · 2012 [cited by applicant]
WO WO2012168199 · 2012 [cited by applicant]
WO WO2012079000 · 2013 [cited by applicant]
WO WO2013123061 · 2013 [cited by applicant]
WO WO2014144622 · 2014 [cited by applicant]
Hudecek et al (Clin Cancer Res 19:3153-64, Jun. 2013 (Year: 2013). [cited by examiner]
Aigner, M., et al., “T Lymphocytes Can Be Effectively Recruited for Ex Vivo and In Vivo Lysis of AML Blasts By a Novel CD33/CD3-Bispecific BITE Antibody Construct,” Leukemia 27:1107-1115 (2013). [cited by applicant]
Appay, V., et al., “CD8+ T Cell Efficacy in Vaccination and Disease,” Nat. Med. 14(6):623-628 (2008). [cited by applicant]
[cited by applicant]
Bhatia, R., et al., “Abnormal Function of the Bone Marrow Microenvironment in Chronic Myelogenous Leukemia:Role of Malignant Stromal Macrophages,” Blood 85:3636-3645 (1995). [cited by applicant]
Brentjens, R. J., et al., “Eradication of Systemic B-Cell Tumors by Genetically Targeted Human T Lymphocytes Co-Stimulated by CD80 and Interleukin-15,” Nat. Med. 9(3):279-286 (2003). [cited by applicant]
Brentjens, R. J., et al., “Safety and Persistence of Adoptively Transferred Autologous CD19-Targeted T Cells in Patients with Relapsed or Chemotherapy Refractory B-Cell Leukemias,” Blood 118:4817-4828 (2011). [cited by applicant]
Brown, C. E., et al., “Recognition and Killing of Brain Tumor Stem-Like Initiating Cells by CD8+ Cytolytic T Cells,” Cancer Res. 69:8886-8893 (2009). [cited by applicant]
Brown, E. J., et al., “Integrin-Associated Protein (CD47) and Its Ligands,” Trends Cell Biol. 11(3):130-135 (2001). [cited by applicant]
Chinese First Office Action in Chinese Application No. 201480024929.6, dated Feb. 1, 2018, 16 pages (with English Translation). [cited by applicant]
Cooper, L. J. N., et al., “T-Cell Clones can be Rendered Specific for CD 19: Toward the Selective Augmentation of the Graft-Versus-B-Lineage Leukemia Effect,” Blood 101:1637-1644 (2003). [cited by applicant]
Dohner, H., et al., “Diagnosis and Management of Acute Myeloid Leukemia in Adults: Recommendations from an International Expert Panel, on Behalf of the European LeukemiaNet,” Blood 115:453-474 (2010). [cited by applicant]
Du, X., et al., “New Immunotoxins Targeting CD123, a Stem Cell Antigen on Acute Myeloid Leukemia Cells,” J. Immunother. 30:607-613 (2007). [cited by applicant]
Dutour, A., et al., “In Vitro and In Vivo Antitumor Effect of Anti-CD33 Chimeric Receptor-Expressing EBV-CTL Against CD33+ Acute Myeloid Leukemia,” Adv. Hematol. 2012:683065 (2012). EFS. [cited by applicant]
Eaves, C. J., et al., “Acute Myeloid Leukemia and the Wnt Pathway,” New Eng. J. Med. 362(24):2326-2327 (2010). [cited by applicant]
European Application No. 14765454.5, Extended European Search Report, dated Dec. 6, 2016, 11 pages. [cited by applicant]
European Application No. 14877876.4, Extended European Search Report, dated Jul. 28, 2017, 10 pages. [cited by applicant]
European Office Action in European Application No. 14877876.4, dated Jul. 13, 2018, 7 pages. [cited by applicant]
European Search Report in European Application No. 19189084.7, dated Feb. 14, 2020, 6 pages. [cited by applicant]
European Search Report in European Application No. 19204610.0, dated Feb. 24, 2020, 13 pages. [cited by applicant]
Flamar et al., “Non-covalent Assembly of Anti-Dendritic Cell Antibodies and Antigens for Evoking Immune Responses in vitro and in vivo,” J Immunol., Sep. 1, 2012, 189(5):2645-2655. [cited by applicant]
Gattinoni, L., et al., “A Human Memory T-Cell Subset with Stem Cell-Like Properties,” Nat. Med. 17(10):1290-1297 (2011). [cited by applicant]
Golden-Mason, L., et al., “Negative Immune Regulator Tim-3 Is Overexpressed on T Cells in Hepatitis C Virus Infection and Its Blockade Rescues Dysfunctional CD4+ and CD8+ T Cells,” J. Virol. 83(18):9122-9130 (2009). [cited by applicant]
Hernandez-Caselles, T., et al., “A Study of CD33 (SIGLEC-3) Antigen Expression and Function on Activated Human land NK Cells: Two Isoforms of CD33 are Generated by Alternative Splicing,” J. Leukocyte Biol. 79:46-58 (200… [cited by applicant]
Hombach et al., “Adoptive immunotherapy with genetically engineered T cells: modification of the IgG1 Fc ‘spacer’ domain in the extracellular moiety of chimeric antigen receptors avoids ‘off-target’ activation and unint… [cited by applicant]
Hudecek, M., et al., “The B-Cell Tumor-Associated Antigen RORI can be Targeted with T Cells Modified to Express a ROR1-Specific Chimeric Antigen Receptor,” Blood 116:4532-4541(2010). [cited by applicant]
Hudecek et al., “The Non-Signaling Extracellular Spacer Domain of CD19-Specific Chimeric Antigen Receptors is Decisive for in vivo Anti-Tumor Activity”, Meeting Abstract No. 951, Blood 2012, 120:951 (2012), 3 pages. [cited by applicant]
Hudecek et al., “Receptor Affinity and Extracellular Domain Modifications Affect Tumor Recognition by ROR1-Specific Chimeric Receptor T Cells,” Clinical Cancer Research, 19(12):3153-3164, Apr. 19, 2013. [cited by applicant]
International Application No. PCT/US14/29109, Notification of Transmittal of the International Search Report and the Written Opinion of the International Searching Authority, mailed Apr. 17, 2015, 16 pages. [cited by applicant]
International Application No. PCT/US2014/028961, Notification of Transmittal of the International Search Report and the Written Opinion of the International Searching Authority, mailed Jul. 28, 2014, 9 pages. [cited by applicant]
Japanese Notice of Reasons for Rejection in Japanese Application No. 2016-502984, dated Feb. 13, 2018 14 pages (with English Translation). [cited by applicant]
Jena, B., et al., “Redirecting T-Cell Specificity by Introducing a Tumor-Specific Chimeric Antigen Receptor,” Blood 116:1035-1044(2010). [cited by applicant]
Jensen, “Abstract IA22: Advanced T cell engineering for cancer immunotherapy,” Cancer Research (2013) vol. 73, No. 1 Supplement, p. IA22 (Abstract IA22) (Published Jan. 2013) [online], Internet <URL: http://cancerres.aa… [cited by applicant]
Jensen, M. C., et al., “Human T Lymphocyte Genetic Modification with Naked DNA, ” Mol. Ther. 1(1):49-55 (2000). [cited by applicant]
Jin, H.T., et al., “Cooperation of Tim-3 and PD-1 in CD8 T-Cell Exhaustion During Chronic Viral Infection,” PNAS 107 (33):14733-14738 (2010). [cited by applicant]
Jin, L., et al., “Monoclonal Antibody-Mediated Targeting of CD123, IL-3 Receptor Alpha Chain, Eliminates Human Acute Myeloid Leukemic Stem Cells,” Cell Stem Cell 5:31-42 (2009). [cited by applicant]
Jonnalagadda et al., “Chimeric antigen receptors (CARs) incorporating mutations in the IgG4 Fc spacer region to eliminate Fc receptor recognition results in improved CAR T cell persistence and anti-tumor efficacy”, Jour… [cited by applicant]
Jonnalagadda et al., “Chimeric Antigen Receptors With Mutated IgG4 Fc Spacer Avoid Fc Receptor Binding and Improve T Cell Persistence and Antitumor Efficacy”, Molecular Therapy, vol. 23, No. 4, Apr. 2015, pp. 757-768. [cited by applicant]
Jordan, C.T., et al., “The Interleukin-3 Receptor Alpha Chain is a Unique Marker for Human Acute Myelogenous Leukemia Stem Cells,” Leukemia 14:1777-1784 (2000). [cited by applicant]
Kalos M. et al. “T Cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia,” Sci. Transl. Med. 3:95ra73 (2011). [cited by applicant]
Kershaw et al., “Gene-engineered T cells for cancer therapy,” Nature Reviews Cancer, Aug. 1, 2013, 13(8):525-541. [cited by applicant]
Kikushige, Y., et al., “TIM-3 Is a Promising Target to Selectively Kill Acute Myeloid Leukemia Stem Cells,” Cell Stem Cell 7:708-717 (2010). [cited by applicant]
Kochenderfer, J. N., et al., “B-Cell Depletion and Remissions of Malignancy Along with Cytokine-Associated Toxicity in a Clinical Trial of Anti-CD19 Chimeric-Antigen-Receptor-Transduced T Cells,” Blood 119:2709-2720 (20… [cited by applicant]
Kochenderfer, J. N., et al., “Construction and Pre-Clinical Evaluation of an Anti-CD19 Chimeric Antigen Receptor,” J. Immunother. 32(7):689-702 (2009). [cited by applicant]
Le Dieu, R., et al., “Peripheral Blood T Cells in Acute Myeloid Leukemia (AML) Patients at Diagnosis Have Abnormal Phenotype and Genotype and Form Defective Immune Synapses with AML Blasts,” Blood 114:3909-3916 (2009). [cited by applicant]
Majeti, R., “Monoclonal Antibody Therapy Directed Against Human Acute Myeloid Leukemia Stem Cells,” Oncogene 30:1009-1019 (2011). [cited by applicant]
Majeti, R., et al., “CD47 Is an Adverse Prognostic Factor and Therapeutic Antibody Target on Human Acute Myeloid Leukemia Stem Cells,” Cell 138:286-299 (2009). [cited by applicant]
Manz, M. G., et al., “Prospective Isolation of Human Clonogenic Common Myeloid Progenitors,” PNAS 99 (18):11872-11877 (2002). [cited by applicant]
Mardiros et al., “CD123-Specific Chimeric Antigen Receptor Redirected T Cells Exhibit Potent Cytolytic Activity and Multiple Effector Functions Against Acute Myeloid Leukemia without Altering Normal Hemotopoietic Colony… [cited by applicant]
Mardiros et al., “T cells expressing CD123-specific chimeric antigen receptors ehibit specific cytolytic effector functions and antitumor effects against human acute myeloid leukemia”, Blood, Oct. 31, 2013, vol. 122, No… [cited by applicant]
Mardiros et al., Materials and Methods, pp. 1-14, Supplement to “T cells expressing CD123-specific chimeric antigen receptors exhibit specific cytolytic effector functions and antitumor effects against human acute myelo… [cited by applicant]
Milone, M. C., et al., “Chimeric Receptors Containing CD137 Signal Transduction Domains Mediate Enhanced Survival of T Cells and Increased Antileukemic Efficacy In Vivo,” Mol. Ther. 17(8):1453-1464 (2009). [cited by applicant]
Moeller, M., et al., “Sustained Antigen-Specific Antitumor Recall Response Mediated by Gene-Modified CD4+ T Helper-1 and CD8+ T Cells,” Cancer Res. 67:11428-11437 (2007). [cited by applicant]
Munoz, L. , et al., “Interleukin-3 Receptor Alpha Chain (CD123) is Widely Expressed in Hematologic Malignancies,” Haematologica 86:1261-1269 (2001). [cited by applicant]
Nakazawa et al., “PiggyBac-mediated cancer immunotherapy using EBV-specific cytotoxic T-cells expressing HER2-specific chimeric antigen receptor.” Molecular Therapy. Dec. 1, 2011, 19(12):2133-43. [cited by applicant]
Nguyen, P., et al., “Identification of a Murine CD28 Dileucine Motif that Suppresses Single-Chain Chimeric T-Cell Receptor Expression and Function,” Blood 102:4320-4325 (2003). [cited by applicant]
Niwa et al., “IgG subclass-independent improvement of antibody-dependent cellular cytotoxicity by fucose removal from Asn297-linked oligosaccharides,” J of Immunol Meth., 2005, 306:151-160. [cited by applicant]
Oka, Y., et al., Induction of WT1 (Wilms' Tumor Gene)-Specific Cytotoxic T Lymphocytes by VVT1 Peptide Vaccine and the Resultant Cancer Regression, PNAS 101(38):13885-13890 (2004). [cited by applicant]
Park et al., “Abstract 1944: In vitro analysis of suicide gene expression and function in human T lymphocytes transduced to express a tumor targeted chimeric antigen receptor,” Cancer Research (2010) vol. 70, No. 8 Supp… [cited by applicant]
Peinert, S., et al., “Gene-Modified T Cells as Immunotherapy for Multiple Myeloma and Acute Myeloid Leukemia Expressing the Lewis Y Antigen,” Gene Therapy 17:678-686 (2010). [cited by applicant]
Pelloquin, F., et al., “Human B Lymphocytes Immortalization by Epstein-Barr Virus in the Presence of Cyclosporin A,” In Vitro Cell. Dev. Biol. 22(12):689-694 (1986). [cited by applicant]
Reddy, M. P., et al., “Elimination of Fc Receptor-Dependent Effector Functions of a Modified IgG4 Monoclonal Antibody to Human CD4,” J. Immunol. 164:1925-1933 (2000). [cited by applicant]
Riddell, S. R., et al., “The use of Anti-CD3 and Anti-CD28 Monoclonal Antibodies to Clone and Expand Human Antigen-Specific T Cells,” J. Immunol. Methods 128:189-201 (1990). [cited by applicant]
Russian Office Action in Russian Application No. 2015140624, dated Feb. 13, 2018, 14 pages (with English Translation). [cited by applicant]
Sato, N., et al., “Expression and Factor-Dependent Modulation of the Interleukin-3 Receptor Subunits on Human Hematopoietic Cells,” Blood 82:752-761 (1993). [cited by applicant]
Savoldo, B., et al., “CD28 Costimulation Improves Expansion and Persistence of Chimeric Antigen Receptor-Modified T Cells in Lymphoma Patients,” J. Clin. Invest. 121(5): 1822-1826 (2011). [cited by applicant]
Schietinger, A., et al., “Bystander Killing of Cancer Requires the Cooperation of CD4+ and CD8+ T Cells During the Effector Phase,” J. Exp. Med. 207(11):2469-2477 (2010). [cited by applicant]
Seder, R. A., et al., “T-Cell Quality in Memory and Protection: Implications for Vaccine Design,” Nat. Rev. Immunol. 8:247-258 (2008). [cited by applicant]
Sievers, E. L., et al.,“Efficacy and Safety of Gemtuzumab Ozogamicin in Patients with CD33-Positive Acute Myeloid Leukemia in First Relapse,” J. Clin. Oncol. 19:3244-3254 (2001). [cited by applicant]
Straathof, K. C., et al., “An Inducible Caspase 9 Safety Switch for 1-Cell Therapy,” Blood 105:4247-4254 (2005). [cited by applicant]
Strohl, W. R., “Optimization of Fc-Mediated Effector Functions of Monoclonal Antibodies,” Curr. Op. Biotech. 20:685-691 (2009). [cited by applicant]
Tettamanti et al., “Targeting of acute myeloid leukaemia by cytokine-induced killer cells redirected with a novel CD123-specific chimeric antigen receptor,” British journal of haematology, May 1, 2013, 161(3):389-401. [cited by applicant]
Thokala et al., “Targeting Leukemias by CD 123 Specific Chimeric Antigen Receptor”, Blood, vol. 118, No. 21, Nov. 18, 2011, 2 pages. [cited by applicant]
Till, B. G. et al., “CD20-Specific Adoptive Immunotherapy for Lymphoma Using a Chimeric Antigen Receptor with Both CD28 and 4-1BB Domains: Pilot Clinical Trial Results,” Blood 119:3940-3950 (2012). [cited by applicant]
Tsimberidou, A.M., et al., “The Role of Gemtuzumab Ozogamicin in Acute Leukaemia Therapy,” Br. J. Haematol. 132:398-409 (2005). [cited by applicant]
Walter, R. B., et al., “Acute Myeloid Leukemia Stem Cells and CD33-Targeted Immunotherapy,” Blood 119:6198-6208 (2012). [cited by applicant]
Wang, X, et al., “A Transgene-Encoded Cell Surface Polypeptide for Selection, In Vivo Tracking, and Ablation of Engineered Cells,” Blood 118:1255-1263 (2011). [cited by applicant]
Yoon, S.H., et al., “Adoptive Immunotherapy Using Human Peripheral Blood Lymphocytes Transferred with RNA Encoding Her-2/Neu-Specific Chimeric Immune Receptor in Ovarian Cancer Xenograft Model, ” Cancer Gene Ther. 16:48… [cited by applicant]
Berger et al., “Adoptive transfer of effector CDS T cells derived from central memory cells establishes persistent T cell memory in primates,” Journal of Clinical Investigation, Jan. 2008, 118(1):294-305. [cited by applicant]
Berger et al., “Analysis of transgene-specific immune responses that limit the in vivo persistence of adoptively transferred HSV-TK-modified donor T cells after allogeneic hematopoietic cell transplantation,” Blood, Mar… [cited by applicant]
Brenner et al., “Adoptive T Cell Therapy of Cancer,” Current Opinion in Immunology, Apr. 2010, 22(2):251-257. [cited by applicant]
Brentjens et al., “CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia,” Science Translational Medicine, Mar. 2013, 5(177):177, 19 pages. [cited by applicant]
Brentjens et al., “Genetically Targeted T Cells Eradicate Systemic Acute Lymphoblastic Leukemia Xenografts,” Clinical Cancer Research, Sep. 2007, 13(18):5426-5435. [cited by applicant]
Cartellieri et al., “Chimeric Antigen Receptor-Engineered T Cells for Immunotherapy of Cancer,” Journal of Biomedicine & Biotechnology, May 2010, 2010(1):956304, 13 pages. [cited by applicant]
Cieri et al., “IL-7 and IL-15 instruct the generation of human memory stem T cells from naive precursors,” Blood, Jan. 2013, 121(4):573-584. [cited by applicant]
De Oliveira et al., “Modification of Hematopoietic Stem/Progenitor Cells with CD19- Specific Chimeric Antigen Receptors as a Novel Approach for Cancer Immunotherapy,” Human Gene Therapy, Oct. 2013, 24(10):824-839. [cited by applicant]
Edelman et al., “The Covalent Structure of An Entire γG Immunoglobulin Molecule,” Proceedings of the National Academy of Sciences, May 1969, 63(1):78-85. [cited by applicant]
Gattinoni et al., “Removal of homeostatic cytokine sinks by lymphodepletion enhances the efficacy of adoptively transferred tumor-specific CD8 [cited by applicant]
Grupp et al., “Chimeric Antigen Receptor-Modified T Cells for Acute Lymphoid Leukemia,” New England Journal of Medicine, Apr. 2013, 368(16):1509-1518. [cited by applicant]
Guest et al., “The Role of Extracellular Spacer Regions in the Optimal Design of Chimeric Immune Receptors: Evaluation of Four Different scFvs and Antigens,” Journal of Immunotherapy, May 2005, 28(3):203-211. [cited by applicant]
Haso et al., “Anti-CD22-chimeric antigen receptors targeting B-cell precursor acute lymphoblastic leukemia,” Blood, Feb. 2013, 121(7):1165-1174. [cited by applicant]
Heslop et al., “Immunotherapy of Hematologic Malignancy,” Hematology, Jan. 2003, 2003(1):331-349. [cited by applicant]
Hinrichs et al., “Human effector CD8 [cited by applicant]
Hombach et al., “Tumor-Specific T Cell Activation by Recombinant Immunoreceptors: CD3ζ Signaling and CD28 Costimulation Are Simultaneously Required for Efficient IL-2 Secretion and Can Be Integrated Into One Combined CD… [cited by applicant]
Huang et al., “Genetically Modified T Cells Targeting Interleukin-11 Receptor α-Chain Kill Human Osteosarcoma Cells and Induce the Regression of Established Osteosarcoma Lung Metastases,” Cancer Research, Jan. 2012, 72(… [cited by applicant]
Imai et al., “Chimeric receptors with 4-1BB signaling capacity provoke potent cytotoxicity against acute lymphoblastic leukemia,” Leukemia, Apr. 2004, 18(4):676-684. [cited by applicant]
Isaacs et al., “Therapy with Monoclonal Antibodies. II. The Contribution of Fcγ Receptor Binding and the Influence of C [cited by applicant]
Ishikawa et al., “Development of functional human blood and immune systems in NOD/SCID/IL2 receptor γ chain [cited by applicant]
Ito et al., “NOD/SCID/γ [cited by applicant]
Jensen et al., “Antitransgene Rejection Responses Contribute to Attenuated Persistence of Adoptively Transferred CD20/CD19-Specific Chimeric Antigen Receptor Redirected T Cells in Humans,” Biology of Blood and Marrow Tr… [cited by applicant]
Jonnalagadda et al., “Engineering Human T Cells for Resistance to Methotrexate and Mycophenolate Mofetil as an In Vivo Cell Selection Strategy,” PLoS One, Jun. 2013, 8(6):e65519, 10 pages. [cited by applicant]
Kahlon et al., “Specific Recognition and Killing of Glioblastoma Multiforme by Interleukin 13-Zetakine Redirected Cytolytic T Cells,” Cancer Research, Dec. 2004, 64(24):9160-9166. [cited by applicant]
Kebriaei et al., “Infusing CD19-Directed T Cells to Augment Disease Control in Patients Undergoing Autologous Hematopoietic Stem-Cell Transplantation for Advanced B-Lymphoid Malignancies,” Human Gene Therapy, May 2012, … [cited by applicant]
Kowolik et al., “CD28 Costimulation Provided through a CD19-Specific Chimeric Antigen Receptor Enhances In Vivo Persistence and Antitumor Efficacy of Adoptively Transferred T Cells,” Cancer Research, Nov. 2006, 66(22): … [cited by applicant]
Nirula et al., “What is IgG4? A review of the biology of a unique immunoglobulin subtype,” Current Opinion in Rheumatology, Jan. 2011, 23(1):119-124. [cited by applicant]
Overwijk et al., “Functions of γC cytokines in immune homeostasis: current and potential clinical applications,” Clinical Immunology, Aug. 2009, 132(2):153-165. [cited by applicant]
Sazinsky et al., “Aglycosylated immunoglobulin G [cited by applicant]
Schroeder et al., “Structure and function of immunoglobulins,” Journal of Allergy and Clinical Immunology, Feb. 2010, 125(2):S41-S52. [cited by applicant]
Stastny et al., “Medulloblastomas Expressing IL13Rγ2 are Targets for IL13-zetakine [cited by applicant]
Steplewski et al., “Biological activity of human-mouse IgG1, IgG2, IgG3, and IgG4 chimeric monoclonal antibodies with antitumor specificity,” Proceedings of the National Academy of Sciences, Jul. 1988, 85(13):4852-4856. [cited by applicant]
Stoop et al., “Serum immunoglobulin levels in healthy children and adults,” Clinical Experimental Immunology, Jan. 1969, 4(1):101-112. [cited by applicant]
Szymczak et al., “Correction of multi-gene deficiency in vivo using a single ‘self-cleaving’ 2A peptide-based retroviral vector,” Nature Biotechnology, May 2004, 22(5):589-594. [cited by applicant]
UniProt Accession No. P01861, “IGHG4_HUMAN,” dated Sep. 13, 2023, 72 pages. [cited by applicant]
Urba et al., “Redirecting T Cells,” New England Journal of Medicine, Aug. 2011, 365(8):754-757. [cited by applicant]
Wang et al., “Engraftment of human central memory-derived effector CD8 [cited by applicant]
Wang et al., “Phenotypic and Functional Attributes of Lentivirus-Modified CD19- specific Human CD8 [cited by applicant]
Wilkie et al., “Retargeting of Human T Cells to Tumor-Associated MUC1: The Evolution of a Chimeric Antigen Receptor,” Journal of Immunology, Apr. 2008, 180(7):4901-4909. [cited by applicant]
Yang et al., “Modulating the differentiation status of ex vivo-cultured anti-tumor T cells using cytokine cocktails,” Cancer Immunology Immunotherapy, Apr. 2013, 62:727-736. [cited by applicant]
Zhong et al., “Chimeric Antigen Receptors Combining 4-1BB and CD28 Signaling Domains Augment PI3kinase/AKT/Bcl-X [cited by applicant]