IP Library › Granted Patent US 12,622,931
Granted Patent B2
US 12,622,931 · App. 17/430,665 · Granted May 12, 2026

Compositions and methods for treating alpha-1 antitrypsin deficiency

Inventors: Nicole Gaudelli (Cambridge, MA); Michael Packer (Cambridge, MA); Bernd Zetsche (Cambridge, MA); Ian Slaymaker (Cambridge, MA); Yi Yu (Cambridge, MA); David A. Born (Cambridge, MA); Seung-Joo Lee (Cambridge, MA)
Assignee: BEAM THERAPEUTICS INC.
A61K35/407A61K31/7088A61K38/465A61K48/0025C12N5/067C12N9/22C12N9/78C12N15/102C12N15/11C12N2310/20C12N2510/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,622,931
App. No.
17/430,665
Granted
May 12, 2026
Kind
B2
Abstract

The present invention features compositions and methods for editing deleterious mutations associated with alpha-1 anti-trypsin (A1AT) deficiency. In particular embodiments, the invention provides methods for correcting mutations in an A1AT polynucleotide using an adenosine deaminase base editor. ABE8, having unprecedented levels of efficiency.

Claims (101)

1 . A method of editing an alpha-1 antitrypsin polynucleotide comprising a single nucleotide polymorphism (SNP) associated with alpha-1 antitrypsin deficiency, the method comprising contacting the polynucleotide with one or more guide RNAs and a base editor comprising a polynucleotide programmable DNA binding domain and at least one base editor domain that comprises an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 compared to the TadA*7.10 amino acid sequence:

(SEQ ID NO: 3)

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIG

LHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIG

RVVFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCYFFR

MPRQVFNAQKKAQSSTD,

wherein said guide RNA targets said base editor to effect an alteration of the SNP associated with alpha-1 antitrypsin deficiency.

2 . The method of claim 1 , wherein the adenosine deaminase variant further comprises alterations at amino acid position 82 and 166.

3 . The method of claim 1 , wherein the adenosine deaminase variant further comprises a V82S alteration.

4 . The method of claim 1 , wherein the adenosine deaminase variant further comprises a T166R alteration.

5 . The method of claim 1 , wherein the adenosine deaminase variant further comprises V82S and T166R alterations and, optionally, one or more of the following alterations: I76Y, Q154S, Y123H, and Q154R.

6 . The method of claim 1 , wherein the adenosine deaminase variant further comprises one of the following combinations of alterations: Q154R; Q154S; V82S+Q154S; V82S; V82S+Q154R; V82S+Y123H; I76Y+V82S; V82S+Y123H+Q154R; Q154R+Y123H; Q154R+I76Y; Q154R+T166R; Y123H+Q154R+I76Y; and I76Y+V82S+Y123H+Q154R.

7 . The method of claim 1 , wherein the base editor domain comprises:

a) an adenosine deaminase variant monomer comprising the adenosine deaminase variant; or

b) an adenosine deaminase heterodimer comprising a wild-type adenosine deaminase domain and the adenosine deaminase variant.

8 . The method of claim 1 , wherein the polynucleotide programmable DNA binding domain is a nuclease inactive or nickase variant.

9 . The method of claim 1 , wherein the contacting occurs in a hepatocyte or hepatocyte progenitor comprising a SNP associated with alpha-1 antitrypsin deficiency,

wherein the alteration of the SNP associated with alpha-1 antitrypsin deficiency is an A·T to G·C alteration,

and wherein when the hepatocyte progenitor is used in the contacting step, the method further comprises (b) differentiating the hepatocyte progenitor into a hepatocyte.

10 . A method of editing an alpha-1 antitrypsin polynucleotide comprising a single nucleotide polymorphism (SNP) associated with alpha-1 antitrypsin deficiency, the method comprising contacting an alpha-1 antitrypsin polynucleotide with one or more guide RNAs and a fusion protein comprising a polynucleotide programmable DNA binding domain comprising an amino acid sequence with at least 90% identity to SEQ ID NO: 13, and at least one base editor domain comprising an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 compared to the TadA*7.10 amino acid sequence:

(SEQ ID NO: 3)

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGL

HDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRV

VFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCYFFRMPR

QVFNAQKKAQSSTD.

11 . The method of claim 10 , wherein the adenosine deaminase variant further comprises alterations at amino acid position 82 and 166.

12 . The method of claim 10 , wherein the adenosine deaminase variant further comprises V82S and/or T166R alterations.

13 . The method of claim 10 , wherein the adenosine deaminase variant further comprises one or more of the following alterations: I76Y, Q154S, Y123H, and Q154R.

14 . The method of claim 10 , wherein the adenosine deaminase variant further comprises one of the following combinations of alterations: Q154R; Q154S; V82S+Q154S; V82S; V82S+Q154R; V82S+Y123H; I76Y+V82S; V82S+Y123H+Q154R; Q154R+Y123H; Q154R+I76Y; Q154R+T166R; Y123H+Q154R+I76Y; and I76Y+V82S+Y123H+Q154R.

15 . A base editor system comprising:

a) a base editor comprising a polynucleotide programmable DNA binding domain and at least one base editor domain that comprises an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 compared to the TadA*7.10 amino acid sequence:

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPTAHAEIMALRQGG LVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAAGSLMDVLHYPGMNHRVEITE GILADECAALLCYFFRMPRQVFNAQKKAQSSTD (SEQ ID NO: 3); and

b) a guide RNA comprising a nucleic acid sequence selected from the group consisting of

(SEQ ID NO: 5)

5′-ACCAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU

AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 6)

5′-CCAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU

AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′;  

(SEQ ID NO: 7)

5′-CAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU

AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 8)

5′-AUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU

AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 9)

5′-UCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU

AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 10)

5′-CGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC AAGUUAAAAU AAGGCUAGUC

CGUUAUCAAC UUGAAAAAGU GGCACCGAGU CGGUGCUUUU-3′.

16 . A pharmaceutical composition or a kit comprising a base editor system comprising:

a) a base editor comprising a polynucleotide programmable DNA binding domain and at least one base editor domain that comprises an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 compared to the TadA*7.10 amino acid sequence:

(SEQ ID NO: 3)

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAI

GLHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSR

IGRVVFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCY

FFRMPRQVFNAQKKAQSSTD;

and

b) a guide RNA comprising a nucleic acid sequence selected from the group consisting of

(SEQ ID NO: 5)

5′-ACCAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 6)

5′-CCAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 7)

5′-CAUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 8)

5′-AUCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′;

(SEQ ID NO: 9)

5′-UCGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′; and

(SEQ ID NO: 10)

5′-CGACAAGAAAGGGACUGA GUUUUAGAGC UAGAAAUAGC 

AAGUUAAAAU AAGGCUAGUC CGUUAUCAAC UUGAAAAAGU 

GGCACCGAGU CGGUGCUUUU-3′;

wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, vehicle, or excipient.

17 . A base editor system comprising a polynucleotide programmable DNA binding domain and at least one base editor domain that comprises an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 of the TadA*7.10 amino acid sequence:

(SEQ ID NO: 3)

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGL

HDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRV

VFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCYFFRMPR

QVFNAQKKAQSSTD

and a guide RNA, wherein said guide RNA targets said base editor to effect an alteration of a SNP associated with alpha-1 antitrypsin deficiency.

18 . The base editor system of claim 17 , wherein the adenosine deaminase variant further comprises a V82S alteration and/or a T166R alteration.

19 . The base editor system of claim 18 , wherein the adenosine deaminase variant further comprises one or more of the following alterations: I76Y, Q154S, Y123H, and Q154R.

20 . A base editor system comprising one or more guide RNAs comprising a nucleic acid sequence complementary to an alpha-1 antitrypsin nucleic acid sequence containing a SNP associated with alpha-1 antiytrypsin deficiency, and a fusion protein comprising a polynucleotide programmable DNA binding domain comprising an amino acid sequence with at least 90% identity to SEQ ID NO: 13, and at least one base editor domain comprising an adenosine deaminase variant comprising an amino acid sequence that is at least 90% identical to the following TadA*7.10 amino acid sequence and that further comprises an arginine or a threonine at amino acid position 147 of the TadA*7.10 amino acid sequence:

(SEQ ID NO: 3)

MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGL

HDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRV

VFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCYFFRMPR

QVFNAQKKAQSSTD.

21 . A cell comprising the base editor system of claim 20 .

Assignments (4)
SECURITY INTEREST Recorded Mar 6, 2026
From: BEAM THERAPEUTICS INC.
To: SIXTH STREET LENDING PARTNERS, AS ADMINISTRATIVE AGENT
Reel/Frame 075021/0929 →
SECURITY INTEREST Recorded Feb 24, 2026
From: BEAM THERAPEUTICS INC.; GUIDE THERAPEUTICS, LLC; BBBR, LLC
To: SIXTH STREET LENDING PARTNERS, AS ADMINISTRATIVE AGENT
Reel/Frame 074955/0064 →
CHANGE OF ADDRESS Recorded Feb 6, 2026
From: BEAM THERAPEUTICS INC.
To: BEAM THERAPEUTICS INC.
Reel/Frame 074716/0696 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 22, 2022
From: GAUDELLI, NICOLE; PACKER, MICHAEL; ZETSCHE, BERND; SLAYMAKER, IAN; YU, YI; BORN, DAVID A.; LEE, SEUNG-JOO
To: BEAM THERAPEUTICS INC.
Reel/Frame 059060/0892 →
Continuity (8)
Provisional Application 62966526 · Jan 27, 2020
Provisional Application 62941569 · Nov 27, 2019
Provisional Application 62931722 · Nov 6, 2019
Provisional Application 62852228 · May 23, 2019
Provisional Application 62852224 · May 23, 2019
Provisional Application 62805238 · Feb 13, 2019
Provisional Application 62805271 · Feb 13, 2019
Related Publication 20230101597A1 · Mar 30, 2023
References Cited (400)
US 7915114B2 · Hsiao et al. · 2011 [cited by applicant]
US 9068179B1 · Liu et al. · 2015 [cited by applicant]
US 9322037B2 · Liu et al. · 2016 [cited by applicant]
US 9388430B2 · Liu et al. · 2016 [cited by applicant]
US 9512446B1 · Joung et al. · 2016 [cited by applicant]
US 9737604B2 · Liu et al. · 2017 [cited by applicant]
US 9840699B2 · Liu et al. · 2017 [cited by applicant]
US 10113163B2 · Liu et al. · 2018 [cited by applicant]
US 10167457B2 · Liu et al. · 2019 [cited by applicant]
US 10465176B2 · Liu et al. · 2019 [cited by applicant]
US 10526401B2 · Muir et al. · 2020 [cited by applicant]
US 10682410B2 · Liu et al. · 2020 [cited by applicant]
US 10745677B2 · Maianti et al. · 2020 [cited by applicant]
US 10912833B2 · Liu et al. · 2021 [cited by applicant]
US 10947530B2 · Liu et al. · 2021 [cited by applicant]
US 11053481B2 · Liu et al. · 2021 [cited by applicant]
US 11124782B2 · Liu et al. · 2021 [cited by applicant]
US 11142550B2 · Muir et al. · 2021 [cited by applicant]
US 11142760B2 · Slaymaker et al. · 2021 [cited by applicant]
US 11155803B2 · Gaudelli et al. · 2021 [cited by applicant]
US 11193123B2 · Halperin · 2021 [cited by applicant]
US 11214780B2 · Liu et al. · 2022 [cited by applicant]
US 11268082B2 · Liu et al. · 2022 [cited by applicant]
US 11306324B2 · Liu et al. · 2022 [cited by applicant]
US 11319532B2 · Liu et al. · 2022 [cited by applicant]
US 11479767B2 · Smith et al. · 2022 [cited by applicant]
US 11542496B2 · Liu et al. · 2023 [cited by applicant]
US 11702651B2 · Liu et al. · 2023 [cited by applicant]
US 11732274B2 · Liu et al. · 2023 [cited by applicant]
US 12129478B1 · Chen et al. · 2024 [cited by applicant]
US 20040003420A1 · Kuhn et al. · 2004 [cited by applicant]
US 20040115184A1 · Smith et al. · 2004 [cited by applicant]
US 20050222030A1 · Allison · 2005 [cited by applicant]
US 20110104787A1 · Church et al. · 2011 [cited by applicant]
US 20130109048A1 · Giugliano et al. · 2013 [cited by applicant]
US 20140068797A1 · Doudna et al. · 2014 [cited by applicant]
US 20140186958A1 · Zhang et al. · 2014 [cited by applicant]
US 20140273226A1 · Wu · 2014 [cited by applicant]
US 20140273230A1 · Chen et al. · 2014 [cited by applicant]
US 20140356956A1 · Church et al. · 2014 [cited by applicant]
US 20150071903A1 · Liu et al. · 2015 [cited by applicant]
US 20150165054A1 · Liu et al. · 2015 [cited by applicant]
US 20150166980A1 · Liu et al. · 2015 [cited by applicant]
US 20150166982A1 · Liu et al. · 2015 [cited by applicant]
US 20150166984A1 · Liu et al. · 2015 [cited by applicant]
US 20150166985A1 · Liu et al. · 2015 [cited by applicant]
US 20150344549A1 · Muir et al. · 2015 [cited by applicant]
US 20160046961A1 · Jinek et al. · 2016 [cited by applicant]
US 20160200779A1 · Liu et al. · 2016 [cited by applicant]
US 20160201089A1 · Gersbach et al. · 2016 [cited by applicant]
US 20160208243A1 · Zhang et al. · 2016 [cited by applicant]
US 20160304846A1 · Liu et al. · 2016 [cited by applicant]
US 20170121693A1 · Liu et al. · 2017 [cited by applicant]
US 20170233703A1 · Xie et al. · 2017 [cited by applicant]
US 20170275648A1 · Barrangou et al. · 2017 [cited by applicant]
US 20170327804A9 · Joung et al. · 2017 [cited by applicant]
US 20180073012A1 · Liu · 2018 [cited by examiner]
US 20180127780A1 · Liu et al. · 2018 [cited by applicant]
US 20180179503A1 · Maianti et al. · 2018 [cited by applicant]
US 20180216095A1 · Thanos et al. · 2018 [cited by applicant]
US 20180237787A1 · Maianti et al. · 2018 [cited by applicant]
US 20180312828A1 · Liu et al. · 2018 [cited by applicant]
US 20190002875A1 · Cheng et al. · 2019 [cited by applicant]
US 20190010481A1 · Joung et al. · 2019 [cited by applicant]
US 20190093099A1 · Liu et al. · 2019 [cited by applicant]
US 20190225955A1 · Liu et al. · 2019 [cited by applicant]
US 20190367891A1 · Liu et al. · 2019 [cited by applicant]
US 20200063127A1 · Lu et al. · 2020 [cited by applicant]
US 20200190493A1 · Liu et al. · 2020 [cited by applicant]
US 20200308571A1 · Joung et al. · 2020 [cited by applicant]
US 20210252118A1 · Slaymaker et al. · 2021 [cited by applicant]
US 20210317440A1 · Liu et al. · 2021 [cited by applicant]
US 20210371858A1 · Evans et al. · 2021 [cited by applicant]
US 20210380955A1 · Bryson et al. · 2021 [cited by applicant]
US 20220047637A1 · Lamothe-Dreuzy et al. · 2022 [cited by applicant]
US 20220119785A1 · Liu et al. · 2022 [cited by applicant]
US 20220127594A1 · Gaudelli et al. · 2022 [cited by applicant]
US 20220136012A1 · Gaudelli et al. · 2022 [cited by applicant]
US 20220169998A1 · Joung et al. · 2022 [cited by applicant]
US 20220170027A1 · Gaudelli et al. · 2022 [cited by applicant]
US 20220220462A1 · Liu et al. · 2022 [cited by applicant]
US 20220290115A1 · Liu et al. · 2022 [cited by applicant]
US 20220290134A1 · Jin et al. · 2022 [cited by applicant]
US 20220290164A1 · Ran et al. · 2022 [cited by applicant]
US 20220307003A1 · Liu · 2022 [cited by applicant]
US 20220387622A1 · Gehrke et al. · 2022 [cited by applicant]
US 20230075877A1 · Gaudelli et al. · 2023 [cited by applicant]
US 20230101597A1 · Gaudelli et al. · 2023 [cited by applicant]
US 20230108687A1 · Liu et al. · 2023 [cited by applicant]
US 20230140953A1 · Slaymaker et al. · 2023 [cited by applicant]
US 20230159956A1 · Bryson et al. · 2023 [cited by applicant]
US 20230212575A1 · Odate et al. · 2023 [cited by applicant]
US 20230348883A1 · Liu et al. · 2023 [cited by applicant]
US 20230383277A1 · Cafferty et al. · 2023 [cited by applicant]
US 20230407277A1 · Joung et al. · 2023 [cited by applicant]
US 20240132867A1 · Gaudelli et al. · 2024 [cited by applicant]
CN 103088008A · 2013 [cited by applicant]
CN 105934516A · 2016 [cited by applicant]
CN 106061510A · 2016 [cited by applicant]
CN 106916852A · 2017 [cited by applicant]
CN 107043779A · 2017 [cited by applicant]
CN 107109413A · 2017 [cited by applicant]
CN 107532161A · 2018 [cited by applicant]
CN 108064282A · 2018 [cited by applicant]
CN 108513575A · 2018 [cited by applicant]
CN 109295186A · 2019 [cited by applicant]
CN 109328231A · 2019 [cited by applicant]
CN 109957569A · 2019 [cited by applicant]
CN 110214180A · 2019 [cited by applicant]
EP 2877490B1 · 2018 [cited by applicant]
EP 3956349A1 · 2022 [cited by applicant]
JP 2017500035A · 2017 [cited by applicant]
JP 6629734B2 · 2020 [cited by applicant]
KR 20160050069A · 2016 [cited by applicant]
WO 2001038547A2 · 2001 [cited by applicant]
WO 2002068676A2 · 2002 [cited by applicant]
WO 2002103028A2 · 2002 [cited by applicant]
WO 2010132092A2 · 2010 [cited by applicant]
WO 2011075627A1 · 2011 [cited by applicant]
WO 2013045632A1 · 2013 [cited by applicant]
WO 2013176772A1 · 2013 [cited by applicant]
WO 2013188037A2 · 2013 [cited by applicant]
WO 2014004336A2 · 2014 [cited by applicant]
WO 2014089290A1 · 2014 [cited by applicant]
WO 2014184143A1 · 2014 [cited by applicant]
WO 2014184741A1 · 2014 [cited by applicant]
WO 2014186686A2 · 2014 [cited by applicant]
WO 2015021426A1 · 2015 [cited by applicant]
WO 2015089277A1 · 2015 [cited by applicant]
WO 2015089406A1 · 2015 [cited by applicant]
WO 2015090230A1 · 2015 [cited by applicant]
WO 2015092024A2 · 2015 [cited by applicant]
WO 2015133554A1 · 2015 [cited by applicant]
WO 2015142675A2 · 2015 [cited by applicant]
WO 2015191693A2 · 2015 [cited by applicant]
WO 2016011210A2 · 2016 [cited by applicant]
WO 2016016343A1 · 2016 [cited by applicant]
WO 2016061368A1 · 2016 [cited by applicant]
WO 2016069910A1 · 2016 [cited by applicant]
WO 2016072399A1 · 2016 [cited by applicant]
WO 2016073649A1 · 2016 [cited by applicant]
WO 2016075612A1 · 2016 [cited by applicant]
WO 2016094304A2 · 2016 [cited by applicant]
WO 2016138038A1 · 2016 [cited by applicant]
WO 2016142532A2 · 2016 [cited by applicant]
WO 2016172727A1 · 2016 [cited by applicant]
WO 2016196308A1 · 2016 [cited by applicant]
WO 2016196388A1 · 2016 [cited by applicant]
WO 2016205711A1 · 2016 [cited by applicant]
WO 2016205759A1 · 2016 [cited by applicant]
WO 2017011721A1 · 2017 [cited by applicant]
WO 2017048969A1 · 2017 [cited by applicant]
WO 2017049166A1 · 2017 [cited by applicant]
WO 2017070632A2 · 2017 [cited by applicant]
WO 2017070633A2 · 2017 [cited by applicant]
WO 2017077386A1 · 2017 [cited by applicant]
WO 2017079703A1 · 2017 [cited by applicant]
WO 2017079705A1 · 2017 [cited by applicant]
WO 2017093804A2 · 2017 [cited by applicant]
WO 2017132580A2 · 2017 [cited by applicant]
WO 2017165862A1 · 2017 [cited by applicant]
WO 2017173054A1 · 2017 [cited by applicant]
WO 2017180993A1 · 2017 [cited by applicant]
WO 2017184768A1 · 2017 [cited by applicant]
WO 2017189308A1 · 2017 [cited by applicant]
WO 2018020323A2 · 2018 [cited by applicant]
WO 2018027036A1 · 2018 [cited by applicant]
WO 2018035388A1 · 2018 [cited by applicant]
WO WO2018027078A1 · 2018 [cited by examiner]
WO 2018041973A1 · 2018 [cited by applicant]
WO 2018085690A1 · 2018 [cited by applicant]
WO 2018089664A1 · 2018 [cited by applicant]
WO 2018119354A1 · 2018 [cited by applicant]
WO 2018119359A1 · 2018 [cited by applicant]
WO 2018129129A1 · 2018 [cited by applicant]
WO 2018160768A1 · 2018 [cited by applicant]
WO 2018165629A1 · 2018 [cited by applicant]
WO 2018176009A1 · 2018 [cited by applicant]
WO 2018213708A1 · 2018 [cited by applicant]
WO 2018213726A1 · 2018 [cited by applicant]
WO 2018218188A2 · 2018 [cited by applicant]
WO 2019005884A1 · 2019 [cited by applicant]
WO 2019005886A1 · 2019 [cited by applicant]
WO 2019023680A1 · 2019 [cited by applicant]
WO 2019040650A1 · 2019 [cited by applicant]
WO 2019071274A1 · 2019 [cited by applicant]
WO 2019079347A1 · 2019 [cited by applicant]
WO 2019120310A1 · 2019 [cited by applicant]
WO 2019139645A2 · 2019 [cited by applicant]
WO 2019183000A1 · 2019 [cited by applicant]
WO 2019217941A1 · 2019 [cited by applicant]
WO 2019217942A1 · 2019 [cited by applicant]
WO 2019217943A1 · 2019 [cited by applicant]
WO 2019217944A1 · 2019 [cited by applicant]
WO 2019226953A1 · 2019 [cited by applicant]
WO 2020028823A1 · 2020 [cited by applicant]
WO 2020041751A1 · 2020 [cited by applicant]
WO 2020051561A1 · 2020 [cited by applicant]
WO 2020112870A1 · 2020 [cited by applicant]
WO 2020160514A1 · 2020 [cited by applicant]
WO 2020160517A1 · 2020 [cited by applicant]
WO 2020163396A1 · 2020 [cited by applicant]
WO 2020168051A1 · 2020 [cited by applicant]
WO 2020168075A1 · 2020 [cited by applicant]
WO 2020168088A1 · 2020 [cited by applicant]
WO 2020168122A1 · 2020 [cited by applicant]
WO 2020168132A1 · 2020 [cited by applicant]
WO 2020168133A1 · 2020 [cited by applicant]
WO 2020168135A1 · 2020 [cited by applicant]
WO 2020214842A1 · 2020 [cited by applicant]
WO 2020236936A1 · 2020 [cited by applicant]
WO 2020236982A1 · 2020 [cited by applicant]
WO 2021020884A2 · 2021 [cited by applicant]
WO 2021022043A2 · 2021 [cited by applicant]
WO 2021042062A2 · 2021 [cited by applicant]
WO 2021050571A1 · 2021 [cited by applicant]
WO 2021055459A1 · 2021 [cited by applicant]
WO 2021081264A1 · 2021 [cited by applicant]
WO 2021087182A1 · 2021 [cited by applicant]
WO 2021108717A2 · 2021 [cited by applicant]
WO 2021158921A2 · 2021 [cited by applicant]
WO 2021175288A1 · 2021 [cited by applicant]
WO 2021207651A2 · 2021 [cited by applicant]
WO 2022008935A1 · 2022 [cited by applicant]
WO 2022015969A1 · 2022 [cited by applicant]
WO 2022056254A2 · 2022 [cited by applicant]
WO 2022056324A1 · 2022 [cited by applicant]
WO 2022081890A1 · 2022 [cited by applicant]
WO 2022112404A1 · 2022 [cited by applicant]
WO 2022148955A1 · 2022 [cited by applicant]
WO 2022150367A1 · 2022 [cited by applicant]
WO 2022150372A1 · 2022 [cited by applicant]
WO 2022150706A2 · 2022 [cited by applicant]
WO 2022204574A1 · 2022 [cited by applicant]
WO 2023279118A2 · 2023 [cited by applicant]
WO 2023288304A2 · 2023 [cited by applicant]
WO 2023034959A2 · 2023 [cited by applicant]
WO 2023047338A1 · 2023 [cited by applicant]
WO 2023049299A2 · 2023 [cited by applicant]
WO 2023125814A1 · 2023 [cited by applicant]
WO 2023155901A1 · 2023 [cited by applicant]
WO 2023227669A3 · 2023 [cited by applicant]
WO 2023247753A1 · 2023 [cited by applicant]
WO 2023248110A1 · 2023 [cited by applicant]
WO 2024040083A1 · 2024 [cited by applicant]
WO 2024063273A1 · 2024 [cited by applicant]
WO 2024073385A2 · 2024 [cited by applicant]
WO 2024179426A2 · 2024 [cited by applicant]
WO 2024226156A1 · 2024 [cited by applicant]
WO 2024227047A2 · 2024 [cited by applicant]
WO 2024259364A2 · 2024 [cited by applicant]
Gaudelli et al., Programmable base editing of A⋅ T to G⋅ C in genomic DNA without DNA cleavage. Nature (2017), 551: 464-471 and Supplemental material (Year: 2017). [cited by examiner]
Nukiwa et al., Identification of a second mutation in the protein-coding sequence of the Z type alpha 1-antitrypsin gene. J of Biol. Chem. (1986), 261: 15989-15994 (Year: 1986). [cited by examiner]
J026191.1 Human Z type alpha-1-antitrypsin gene, complete cds (exons 2-5); https://www.ncbi.nlm.nih.gov/nucleotide/J02619.1 [retrieved Mar. 17, 2025], available Oct. 30, 1994 (Year: 1994). [cited by examiner]
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature (2015), 523: 481-485 and Supplemental Material (Year: 2015). [cited by examiner]
Elias et al., Biochemical and Structural Studies of A-to-I Editing by tRNA:A34 Deaminases at the Wobble Position of Transfer RNA,. Biochemistry (2005), 44: 12057-12065 (Year: 2005). [cited by examiner]
U.S. Appl. No. 14/325,815, filed Jul. 6, 2021, Liu et al. [cited by applicant]
Addgene Plasmid No. 44246, Create Date Feb. 28, 2013. [cited by applicant]
Addgene Plasmid No. 73021, Create Date Apr. 20, 2016. [cited by applicant]
Addgene Plasmid No. 79620, Create Date Aug. 4, 2016. [cited by applicant]
Alexandrov et al., “Signatures of mutational processes in human cancer,” Nature, Aug. 22, 2013, vol. 500, pp. 415-421. [cited by applicant]
Andries et al., “N1-methylpseudouridine-incorporated mRNA outperforms pseudouridine-incorporated mRNA by providing enhanced protein expression and reduced immunogenicity in mammalian cell lines and mice,” Journal of Con… [cited by applicant]
Azad et al., “Site-directed RNA editing by adenosine deaminase acting on RNA for correction of the genetic code in gene therapy,” Gene Therapy, 2017, vol. 24, pp. 779-786. [cited by applicant]
Bae et al., “Cas-OFFinder: a fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases,” Bioinformatics, Jan. 24, 2014, vol. 30, No. 10, pp. 1473-1475. [cited by applicant]
Baligar et al., “Bone marrow stem cell therapy partially ameliorates pathological consequences in livers of mice expressing mutant human α1-antitrypsin,” Hepatology, Apr. 2017, vol. 65, No. 4, pp. 1319-1335. [cited by applicant]
Billon et al., “CRISPR-Mediated Base Editing Enables Efficient Disruption of Eukaryotic Genes through Induction of STOP Codons,” Molecular Cell, Sep. 21, 2017, vol. 67, pp. 1068-1079. [cited by applicant]
Bjursell et al., “Therapeutic Genome Editing With CRISPR/Cas9 in a Humanized Mouse Model Ameliorates α1-antitrypsin Deficiency Phenotype,” EBioMedicine, 2018, vol. 29, pp. 104-111. [cited by applicant]
Branden and Tooze, “The Building Blocks,” Introduction to Protein Structure, 1999, vol. 2, pp. 3-12. [cited by applicant]
Briner et al., “Guide RNA Functional Modules Direct Cas9 Activity and Orthogonality,” Molecular Cell, Oct. 23, 2014, vol. 56, pp. 333-339. [cited by applicant]
Bulow et al., “Multienzyme systems obtained by gene fusion,” Trends in Biotechnology, Jan. 1991, vol. 9, pp. 226-231. [cited by applicant]
Cameron, Ewan R., “Recent Advances in Transgenic Technology,” Molecular Biotechnology, 1997, vol. 7, pp. 253-265. [cited by applicant]
Chadwick et al., “In Vivo Base Editing of PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) as a Therapeutic Alternative to Genome Editing,” Arteriosclerosis, Thrombosis, and Vascular Biology, Sep. 2017, vol. 37, pp… [cited by applicant]
Chatterjee et al., “A Cas9 with PAM recognition for adenine dinucleotides,” Nature Communications, 2020, vol. 11, No. 2474, pp. 1-6. [cited by applicant]
Chester et al., “The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay,” The EMBO Journal, 2003, vol. 22, No. 15, pp. 3971-3982. [cited by applicant]
Chichili et al., “Linkers in the structural biology of protein-protein interactions,” Protein Science, 2013, vol. 22, pp. 153-167. [cited by applicant]
Chylinski et al., “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems,” RNA Biology, May 2013, vol. 10, No. 5, pp. 726-737. [cited by applicant]
Collantes et al., “Development and Characterization of a Modular CRISPR and RNA Aptamer Mediated Base Editing System,” The CRISPR Journal, 2021, vol. 4, No. 1, pp. 58-68. [cited by applicant]
Cong et al., “Multiplex Genome Engineering Using CRISPR/Cas Systems,” Science, Feb. 15, 2013, vol. 339, No. 6121, pp. 819-823. [cited by applicant]
Deltcheva et al., “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III,” Nature, Mar. 31, 2011, vol. 471, pp. 602-607. [cited by applicant]
Endo et al., “Toward establishing an efficient and versatile gene targeting system in higher plants,” Biocatalysis and Agricultural Biotechnology, 2014, vol. 3, pp. 2-6. [cited by applicant]
Ferretti et al., “Complete genome sequence of an M1 strain of [cited by applicant]
Fonfara et al., “Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems,” Nucleic Acids Research, 2014, vol. 42, No. 4, pp. 2577-2590. [cited by applicant]
Freshney et al., “Culture of Animal Cells, A Manual of Basic Technique,” Food and Chemical Toxicology, 1983, vol. 23, No. 3, pp. 403-404. [cited by applicant]
Fu et al., “Human cell based directed evolution of adenine base editors with improved efficiency,” Nature Communications, 2021, vol. 12, No. 5897, pp. 1-11. [cited by applicant]
Gardlik et al., “Vectors and delivery systems in gene therapy,” Medical Science Monitor, 2005, vol. 11, No. 4, pp. RA110-RA121. [cited by applicant]
Gasiunas et al., “Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria,” Proceedings of the National Academy of Sciences of the United States of America, Sep. 4, 2012, pp… [cited by applicant]
Gasiunas et al., “RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing?” Trends in Microbiology, Nov. 2013, vol. 21, No. 11, pp. 562-567. [cited by applicant]
Gaudelli et al., “Directed evolution of adenine base editors with increased activity and therapeutic application,” Nature Biotechnology, 2020, pp. 1-15. [cited by applicant]
Gaudelli et al., “Programmable base editing of A⋅T to G⋅C in genomic DNA without DNA cleavage,” Nature, Nov. 23, 2017, vol. 551, pp. 464-471. [cited by applicant]
GenBank Accession No. NM_000295.4, “ [cited by applicant]
Grunewald et al., “CRISPR DNA base editors with reduced RNA off-target and self-editing activities,” Nature Biotechnology, Sep. 2019, vol. 37, No. 9, pp. 1041-1048. [cited by applicant]
Grunewald et al., “Transcriptome-wide off-target RNA editing induced by CRISPR-guided DNA base editors,” Nature, May 2019, vol. 569, No. 7756, pp. 433-437. [cited by applicant]
Guilinger et al., “Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification,” Nature Biotechnology, 2014, pp. 1-6. [cited by applicant]
Guo et al., “Protein tolerance to random amino acid change,” Proceedings of the National Academy of Sciences of the United States of America, Jun. 22, 2004, vol. 101, No. 25, pp. 9205-9210. [cited by applicant]
Hess et al., “Methods and Applications of CRISPR-Mediated Base Editing in Eukaryotic Genomes,” Molecular Cell, Oct. 5, 2017, vol. 68, pp. 26-43. [cited by applicant]
Hill et al., “Functional Analysis of Conserved Histidines in ADP-Glucose Pyrophosphorylase from [cited by applicant]
Houdebine, Louis-Marie, “The methods to generate transgenic animals and to control transgene expression,” Journal of Biotechnology, 2002, vol. 98, pp. 145-160. [cited by applicant]
Hu et al., “Evolved Cas9 variants with broad PAM compatibility and high DNA specificity,” Nature, Apr. 5, 2018, vol. 556, pp. 57-63. [cited by applicant]
Hua et al., “Expanding the base editing scope in rice by using Cas9 variants,” Plant Biotechnology Journal, 2019, vol. 17, pp. 499-504. [cited by applicant]
Huang et al., “Circularly permuted and PAM-modified Cas9 variants broaden the targeting scope of base editors,” Nature Biotechnology, Jun. 2019, vol. 37, No. 6, pp. 626-631. [cited by applicant]
Huang et al., “DNA epigenome editing using CRISPR-Cas SunTag-directed DNMT3A,” Genome Biology, 2017, vol. 18, No. 176, pp. 1-11. [cited by applicant]
Jeong et al., “Adenine base editor engineering reduces editing of bystander cytosines,” Nature Biotechnology, 2021, pp. 1-12. [cited by applicant]
Jeong et al., “Precise adenine base editors that exhibit minimized cytosine catalysis,” Research Square, 2020, pp. 1-15. [cited by applicant]
Jha et al., “Single amino acid substitutions in recombinant plant-derived human α1-proteinase inhibitor confer enhanced stability and functional efficacy,” Biochimica et Biophysica Acta, 2014, vol. 1840, pp. 416-427. [cited by applicant]
Jiang et al., “Chemical modifications of adenine base editor mRNA and guide RNA expand its application scope,” Nature Communications, 2020, vol. 11, No. 1979, pp. 1-9. [cited by applicant]
Jin et al., “Cytosine, but not adenine, base editors induce genome-wide off-target mutations in rice,” Science, Apr. 19, 2019, vol. 364, pp. 292-295. [cited by applicant]
Jinek et al., “A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity,” Science, Aug. 17, 2012, vol. 337, No. 6096, pp. 816-821. [cited by applicant]
Jinek et al., “RNA-programmed genome editing in human cells,” eLife, 2013, vol. 2, No. e00471, pp. 1-9. [cited by applicant]
Jore et al., “Structural basis for CRISPR RNA-guided DNA recognition by Cascade,” Nature Structural & Molecular Biology, May 2011, vol. 18, No. 5, pp. 529-537. [cited by applicant]
Kappel et al., “Regulating gene expression in transgenic animals,” Current Opinion in Biotechnology, 1992, vol. 3, pp. 548-553. [cited by applicant]
Kim et al., “Adenine base editors catalyze cytosine conversions in human cells,” Nature Biotechnology, Oct. 2019, vol. 37, pp. 1145-1148. [cited by applicant]
Kim et al., “Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins,” Genome Research, 2014, vol. 24, pp. 1012-1019. [cited by applicant]
Kim et al., “Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions,” Nature Biotechnology, 2017, pp. 1-7. [cited by applicant]
Kim et al., “Rescue of high-specificity Cas9 variants using sgRNAs with matched 5′ nucleotides,” Genome Biology, 2017, vol. 18, No. 218, pp. 1-6. [cited by applicant]
Kim et al., “Transcriptional Repression by Zinc Finger Peptides,” The Journal of Biological Chemistry, Nov. 21, 1997, vol. 272, No. 47, pp. 29795-29800. [cited by applicant]
Kim et al., “Structural and Kinetic Characterization of [cited by applicant]
Kitamura et al., “Uracil DNA Glycosylase Counteracts APOBEC3G-Induced Hypermutation of Hepatitis B Viral Genomes: Excision Repair of Covalently Closed Circular DNA,” PLOS Pathogens, May 2013, vol. 9, No. 5, e1003361, pp… [cited by applicant]
Kleinstiver et al., “Broadening [cited by applicant]
Kleinstiver et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities,” Nature, Jul. 23, 2015, vol. 523, pp. 481-485. [cited by applicant]
Kleinstiver et al., “High-fidelity CRISPR-Cas9 variants with undetectable genome-wide off-targets,” Molecular Therapy, Jan. 28, 2016, vol. 529, No. 75187, pp. 490-495. [cited by applicant]
Koblan et al., “Improving cytidine and adenine base editors by expression optimization and ancestral reconstruction,” Nature Biotechnology, 2018, pp. 1-4. [cited by applicant]
Komor et al., “Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity,” Science Advances, Aug. 30, 2017, vol. 3, No. eaao4774, … [cited by applicant]
Komor et al., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage,” Nature, May 19, 2016, vol. 533, pp. 420-424. [cited by applicant]
Kundu et al., “Leucine to proline substitution by SNP at position 197 in Caspase-9 gene expression leads to neuroblastoma: a bioinformatics analysis,” 3 Biotech, 2013, vol. 3, pp. 225-234. [cited by applicant]
Lapinaite et al., “DNA capture by a CRISPR-Cas9-guided adenine base editor,” Science, Jul. 31, 2020, vol. 369, No. 6503, pp. 566-571. [cited by applicant]
Lau et al., “Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG,” Proceedings of the National Academy of Sciences of the United States of America, Dec. 5, 2000… [cited by applicant]
Lazar et al., “Transforming Growth Factor α: Mutation of Aspartic Acid 47 and Leucine 48 Results in Different Biological Activities,” Molecular and Cellular Biology, Mar. 1988, vol. 8, No. 3, pp. 1247-1252. [cited by applicant]
Lee et al., “CRISPR-Pass: Gene Rescue of Nonsense Mutations Using Adenine Base Editors,” Molecular Therapy, Aug. 2019, vol. 27, No. 8, pp. 1364-1371. [cited by applicant]
Lee et al., “Cytosine but not adenine base editor generates mutations in mice,” bioRxiv, 2019, pp. 1-24. [cited by applicant]
Lee et al., “PIK3CA gene is frequently mutated in breast carcinomas and hepatocellular carcinomas,” Oncogene, 2005, vol. 24, pp. 1477-1480. [cited by applicant]
Lenk et al., “Pathogenic Mechanism of the FIG4 Mutation Responsible for Charcot-Marie-Tooth Disease CMT4J,” PLoS Genetics, Jun. 2011, vol. 7, No. 6, e1002104, pp. 1-13. [cited by applicant]
Li et al., “Current Approaches for Engineering Proteins with Diverse Biological Properties,” Bio-Applications of Nanoparticles, 2007, pp. 1-16. [cited by applicant]
Liu et al., “C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism,” Molecular Cell, Jan. 19, 2017, vol. 65, pp. 310-322. [cited by applicant]
Lyons et al., “Efficient Recognition of an Unpaired Lesion by a DNA Repair Glycosylase,” Journal of the American Chemical Society, 2009, vol. 131, No. 49, pp. 17742-17743. [cited by applicant]
Ma et al., “Targeted AID-mediated mutagenesis (TAM) enables efficient genomic diversification in mammalian cells,” Nature Methods, Dec. 2016, vol. 13, No. 12, pp. 1029-1035. [cited by applicant]
Makarova et al., “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?,” The CRISPR Journal, 2018, vol. 1, No. 5, pp. 325-336. [cited by applicant]
Mali et al., “Cas9 as a versatile tool for engineering biology,” Nature Methods, Oct. 2013, vol. 10, No. 10, pp. 957-963. [cited by applicant]
Mali et al., “CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering,” Nature Biotechnology, 2013, pp. 1-6. [cited by applicant]
Mccann et al., “MagnEdit—interacting factors that recruit DNA-editing enzymes to single base targets,” Life Science Alliance, 2020, vol. 3, No. 4, e201900606, pp. 1-9. [cited by applicant]
Mikami et al., “Comparison of CRISPR/Cas9 expression constructs for efficient targeted mutagenesis in rice,” Plant Molecular Biology, 2015, vol. 88, pp. 561-572. [cited by applicant]
Miller et al., “Continuous evolution of SpCas9 variants compatible with non-G PAMs,” Nature Biotechnology, Apr. 2020, vol. 38, No. 4, pp. 471-481. [cited by applicant]
Mohamad et al., “Human hemoglobin G-Makassar variant masquerading as sickle cell anemia,” Hematology Reports, 2018, vol. 10, No. 7210, pp. 92-95. [cited by applicant]
Mullins et al., “Transgenesis in Nonmurine Species,” Hypertension, Oct. 1993, vol. 22, No. 4, pp. 630-633. [cited by applicant]
Navaratnam et al., “An Overview of Cytidine Deaminases,” International Journal of Hematology, 2006, vol. 83, pp. 195-200. [cited by applicant]
Nishida et al., “Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems,” Science, Sep. 16, 2016, vol. 353, No. 6305, pp. 1248-aaf8729-8. [cited by applicant]
Nishimasu et al., “Engineered CRISPR-Cas9 nuclease with expanded targeting space,” Science, 2018, vol. 361, pp. 1259-1262. [cited by applicant]
Okumura et al., “Evolutionary paths of streptococcal and staphylococcal superantigens,” BMC Genomics, 2012, vol. 13, No. 404, pp. 1-16. [cited by applicant]
Parr et al., “N1-Methylpseudouridine substitution enhances the performance of synthetic mRNA switches in cells,” Nucleic Acids Research, 2020, vol. 48, No. 6, e35, pp. 1-9. [cited by applicant]
Pausch et al., “CRISPR-Casφ from huge phages is a hypercompact genome editor,” Science, Jul. 17, 2020, vol. 369, No. 6501, pp. 333-337. [cited by applicant]
Phillips, Anthony J., “The challenge of gene therapy and DNA delivery,” Journal of Pharmacy and Pharmacology, 2001, vol. 53, pp. 1169-1174. [cited by applicant]
Poller et al., “A Leucine-to-Proline Substitution Causes a Defective α1-Antichymotrypsin Allele Associated with Familial Obstructive Lung Disease,” Genomics, 1993, vol. 17, pp. 740-743. [cited by applicant]
Pournasr et al., “Modeling Inborn Errors of Hepatic Metabolism Using Induced Pluripotent Stem Cells,” Arteriosclerosis, Thrombosis, and Vascular Biology, 2017, vol. 37, pp. 1994-1999. [cited by applicant]
Putnam et al., “Protein Mimicry of DNA from Crystal Structures of the Uracil-DNA Glycosylase Inhibitor Protein and its Complex with [cited by applicant]
Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression,” Cell, Feb. 28, 2013, vol. 152, pp. 1173-1183. [cited by applicant]
Ran et al., “In vivo genome editing using [cited by applicant]
Rees et al., “Analysis and minimization of cellular RNA editing by DNA adenine base editors,” Science Advances, May 8, 2019, vol. 5, No. eaax5717, pp. 1-10. [cited by applicant]
Rees et al., “Base editing: precision chemistry on the genome and transcriptome of living cells,” Nature Reviews Genetics, Dec. 2018, vol. 19, No. 12, pp. 770-788. [cited by applicant]
Baños-Sanz et al., “Crystal structure and functional insights into uracil-DNA glycosylase inhibition by phage φ29 DNA mimic protein p56,” Nucleic Acids Research, 2013, vol. 41, No. 13, pp. 6761-6773. [cited by applicant]
Cartegni et al., “Determinants of Exon 7 Splicing in the Spinal Muscular Atrophy Genes, SMN1 and SMN2,” The American Journal of Human Genetics, Jan. 2006, vol. 78, pp. 63-77. [cited by applicant]
Casini et al., “A highly specific SpCas9 variant is identified by in vivo screening in yeast,” Nature Biotechnology, Mar. 2018, vol. 36, No. 3, pp. 265-271 and pp. 15-20 containing Figures (20 total pages). [cited by applicant]
Chang et al., “Degradation of survival motor neuron (SMN) protein is mediated via the ubiquitin/proteasome pathway,” Neurochemistry International, 2004, vol. 45, pp. 1107-1112. [cited by applicant]
Charpentier et al. “Rewriting a genome”, Nature, Mar. 2013, vol. 495, No. 7439, pp. 50-51. [cited by applicant]
Chen et al. “Targeting genomic rearrangements in tumor cells through Cas9-mediated insertion of a suicide gene.” Nature Biotechnology, Jun. 2017, vol. 35, No. 6, pp. 543-552. [cited by applicant]
Cho et al., “A degron created by SMN2 exon 7 skipping is a principal contributor to spinal muscular atrophy severity,” Genes & Development, 2010, vol. 24, pp. 438-442. [cited by applicant]
Corcia et al., “The importance of the SMN genes in the genetics of sporadic ALS,” Amyotrophic Lateral Sclerosis, 2009, vol. 10, pp. 436-440. [cited by applicant]
Corti et al., “Genetic Correction of Human Induced Pluripotent Stem Cells from Patients with Spinal Muscular Atrophy,” Science Translational Medicine, Dec. 19, 2012, vol. 4, Article No. 165, pp. 1-20 and pp. 21-32 conta… [cited by applicant]
Cucchiarini et al., “Enhanced expression of the central survival of motor neuron (SMN) protein during the pathogenesis of osteoarthritis,” Journal of Cellular and Molecular Medicine, 2014, vol. 18, No. 1, pp. 115-124. [cited by applicant]
De Souza. “Primer: genome editing with engineered nucleases.” Nature Methods, vol. 9, No. 1, Jan. 2012, pp. 27-27. [cited by applicant]
Doudna, Jennifer A., “The Promise and Challenge of Therapeutic Genome Editing,” Nature, Feb. 2020, vol. 578, Article No. 7794, pp. 229-236 and pp. 20-24 containing Figures (24 total pages). [cited by applicant]
D'Ydewalle et al., “The Antisense Transcript SMN-AS1 Regulates SMN Expression and Is a Novel Therapeutic Target for Spinal Muscular Atrophy,” Neuron, Jan. 4, 2017, vol. 93, pp. 63-79. [cited by applicant]
Fagagna et al., “The Gam protein of bacteriophage Mu is an orthologue of eukaryotic Ku,” EMBO reports, 2003, vol. 4, No. 1, pp. 47-52. [cited by applicant]
GenBank Protein No. 4UN5_B, downloaded Jan. 9, 2024. [cited by applicant]
GenBank Accession No. AIT42264.1, downloaded Jan. 9, 2024. [cited by applicant]
GenBank Accession No. AKA60242.1, downloaded Jan. 9, 2024. [cited by applicant]
GenBank Accession No. AKQ21048.1, downloaded Jan. 9, 2024. [cited by applicant]
GenBank Accession No. AKS40380.1, downloaded Jan. 9, 2024. [cited by applicant]
GenBank Accession No. CTS26096.1, downloaded Apr. 9, 2024. [cited by applicant]
GenBank Locus No. LC169509.1, downloaded Aug. 10, 2023. [cited by applicant]
Geneseq, “ [cited by applicant]
Geneseq, “ [cited by applicant]
Geneseq, “Adenine deaminase polypeptide SEQ: 49.”, XP002808137, retrieved from EBI accession No. GSP: BJG44493 Database accession No. BJG44493 sequence -& Datbse Geneseq [Online], Jun. 10, 2021. [cited by applicant]
Greene et al., “Alpha-1 Antitrypsin Deficiency: Recent Developments in Gene Therapy Research,” Gene Therapy Application, 2011, vol. 25, pp. 449-460. [cited by applicant]
Grimm et al., In vitro and In vivo Gene Therapy Vector Evolution via Multispecies Interbreeding and Retargeting of Adeno-Associated Viruses. J. Virol., 2008, vol. 82, p. 5887-5911. [cited by applicant]
Hendel et al., “Chemically modified guide RNAs enhance CRISPR-Cas genome editing in human primary cells,” Nature Biotechnology, Sep. 2015, vol. 33, Article No. 9, pp. 985-989 and pp. 13-14 containing Figures (14 total p… [cited by applicant]
Jeong et al., “Measurement of deoxyinosine adduct: Can it be a reliable tool to assess oxidative or nitrosative DNA damage?,” Toxicology Letters, 2012, vol. 214, pp. 226-233. [cited by applicant]
Le et al., “SMND7, the major product of the centromeric survival motor neuron (SMN2 ) gene, extends survival in mice with spinal muscular atrophy and associates with full-length SMN,” Human Molecular Genetics, 2005, vol… [cited by applicant]
Lefebvre et al., “Identification and Characterization of a Spinal Muscular Atrophy-Determining Gene,” Jan. 13, 1995, vol. 80, pp. 155-165. [cited by applicant]
Lei et al., “Glucose-6-phosphatase dependent substrate transport in the glycogen storage disease type-1a mouse,” Nature Genetics, Jun. 1996, vol. 13, pp. 203-209. [cited by applicant]
Lin et al., “[Construction and evaluation of DnaB split intein high expression vector and a six amino acids cyclic peptide library],” Chinese Journal of Biotechnology, Nov. 1, 2008, vol. 24, No. 11, pp. 1924-1930 [Engli… [cited by applicant]
Liu, et al. “Crossing the blood-brain barrier with AAV vectors,” Metabolic Brain Disease, 2021, vol. 36, pp. 45-52. [cited by applicant]
Lorson et al., “A single nucleotide in the SMN gene regulates splicing and is responsible for spinal muscular atrophy,” Proceedings of the National Academy of Sciences of the United States of America, May 1999, vol. 96,… [cited by applicant]
Lutz et al., “Postsymptomatic restoration of SMN rescues the disease phenotype in a mouse model of severe spinal muscular atrophy,” The Journal of Clinical Investigation, Aug. 2011, vol. 121, No. 8, pp. 3029-3041. [cited by applicant]
Maeder et al. “CRISPR RNA-guided activation of endogenous human genes”, Nature Methods, Oct. 2013, vol. 10, No. 10, pp. 977-979. [cited by applicant]
Monani et al., “A single nucleotide difference that alters splicing patterns distinguishes the SMA gene SMN1 from the copy gene SMN2,” Human Molecular Genetics, 1999, vol. 8, No. 7, pp. 1177-1183. [cited by applicant]
Murray et al., “Selective vulnerability of motor neurons and dissociation of pre- and post-synaptic pathology at the neuromuscular junction in mouse models of spinal muscular atrophy,” Human Molecular Genetics, 2008, vo… [cited by applicant]
NCBI Reference Sequence No. NC_000001.11, downloaded Jan. 9, 2024. [cited by applicant]
NCBI Reference Sequence No. WP_001297409.1, downloaded Aug. 14, 2023. [cited by applicant]
NCBI Reference Sequence No. WP_002989955.1, downloaded Jan. 9, 2024. [cited by applicant]
NCBI Reference Sequence No. WP_010922251.1, downloaded Jan. 9, 2024. [cited by applicant]
NCBI Reference Sequence No. WP_011054416.1, downloaded Jan. 9, 2024. [cited by applicant]