IP Library › Granted Patent US 12,734,217
Granted Patent B1
US 12,734,217 · App. 19/355,744 · Granted Sep 15, 2026

Kits for preparing and delivering purified corticotropin

Inventors: Edward M. DeSimone, III (Indianapolis, MN); Weijun Cheng (Middleton, WI); Zachary Holcomb (Waunakee, WI)
Assignee: ANI Pharmaceuticals, Inc.
A61K38/2228A61J1/065A61J1/1412A61J1/1443A61J1/1468A61J1/20A61K38/22A61K38/35A61K47/10A61K47/42B65D39/00A61J2200/42
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,734,217
App. No.
19/355,744
Granted
Sep 15, 2026
Kind
B1
Abstract

A kit and sterile preparation of purified corticotropin and methods relating thereto in which the preparation includes corticotropin extracted from a whole porcine pituitary gland including both anterior and posterior portions, and having proteins or peptides having a molecular weight higher than 4.6 kDa removed. Methods of manufacturing, testing, increasing stability, storage, and use of the purified corticotropin are also provided.

Claims (36)

1 . A vial containing a sterile preparation of purified corticotropin, wherein the sterile preparation comprises 80 USP units per mL of the purified corticotropin, gelatin, and water for injection (WFI), wherein the purified corticotropin comprises a polypeptide having an amino acid sequence of SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF (SEQ ID NO: 1), and wherein the vial is not terminally sterilized.

2 . The vial of claim 1 , wherein the sterile preparation comprises 0.5% w/w phenol and 15% w/w gelatin.

3 . The vial of claim 1 , wherein the sterile preparation has a pH of 3.0-7.0.

4 . The vial of claim 1 , wherein the sterile preparation comprises purified corticotropin comprising an extract from whole porcine pituitary gland including both anterior and posterior portions of the whole porcine pituitary gland, 0.5% w/w phenol, and 15% w/w gelatin.

5 . The vial of claim 1 , wherein the sterile preparation comprises about 15% w/w of the gelatin.

6 . The vial of claim 1 , wherein the sterile preparation comprises about 150 mg/ml of the gelatin.

7 . The vial of claim 6 , wherein the sterile preparation comprises about 0.1-1% w/w of phenol.

8 . The vial of claim 7 , wherein the sterile preparation comprises about 0.5% w/w of the phenol.

9 . The vial of claim 6 , wherein the sterile preparation comprises about 5 mg/ml of phenol.

10 . The vial of claim 1 , wherein the sterile preparation is preservative-free, antimicrobial-free, or preservative-free and antimicrobial-free.

11 . The vial of claim 1 , wherein the gelatin is type A gelatin.

12 . The vial of claim 1 , wherein the sterile preparation is free of acetic acid.

13 . The vial of claim 1 , wherein the gelatin is pyrogen-free.

14 . The vial of claim 1 , wherein

a) the sterile preparation is preservative-free, antimicrobial-free, or preservative-free and antimicrobial-free,

b) the gelatin is type A gelatin,

c) the sterile preparation is free of acetic acid,

d) the gelatin is pyrogen-free,

e) the sterile preparation comprises hydrochloric acid and sodium hydroxide,

f) the sterile preparation has a pH of 3.0-7.0, and

g) the sterile preparation comprises purified corticotropin comprising an extract from whole porcine pituitary gland including both anterior and posterior portions of the whole porcine pituitary gland, 0.5% w/w phenol, and 15% w/w gelatin.

15 . The vial of claim 1 , wherein the vial is a multiple-dose vial.

16 . The vial of claim 15 , wherein:

a) the sterile preparation is preservative-free, antimicrobial-free, or preservative-free and antimicrobial-free,

b) the gelatin is type A gelatin,

c) the sterile preparation is free of acetic acid,

d) the gelatin is pyrogen-free,

e) the sterile preparation comprises hydrochloric acid and sodium hydroxide,

f) the sterile preparation has a pH of 3.0-7.0,

g) the sterile preparation comprises purified corticotropin comprising an extract from whole porcine pituitary gland including both anterior and posterior portions of the whole porcine pituitary gland, 0.5% w/w phenol, and 15% w/w gelatin,

h) the sterile preparation comprises about 15% w/w of the gelatin,

i) the sterile preparation comprises about 150 mg/ml of the gelatin,

j) the sterile preparation comprises about 0.5% w/w of phenol, and/or

k) the sterile preparation comprises about 5 mg/ml of phenol.

17 . A method of treating a human subject comprising warming the vial containing the sterile preparation of purified corticotropin of claim 1 to a temperature of 18° to 26° C., and injecting 80 United States Pharmacopeia (USP) units of the sterile preparation of purified corticotropin into the human subject, wherein the human subject has systemic lupus erythematosus, acute exacerbations of multiple sclerosis (MS), acute gouty arthritis, severe psoriasis, atopic dermatitis, or allergic conjunctivitis.

18 . The vial of claim 1 , wherein the gelatin has a gel point in the range of 18 to 24° C.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jun 22, 2026
From: DESIMONE, EDWARD M., III; CHENG, WEIJUN; HOLCOMB, ZACHARY
To: ANI PHARMACEUTICALS, INC.
Reel/Frame 075036/0492 →
Continuity (4)
Continuation 19199523 · May 6, 2025
Continuation 18905498 · Oct 3, 2024
Continuation 18496150 · Oct 27, 2023
Provisional Application 63381451 · Oct 28, 2022
References Cited (52)
US 2992165A · Thompson · 1961 [cited by examiner]
US 4374063A · Consolazio · 1983 [cited by applicant]
US 6461334B1 · Buch-Rasmussen · 2002 [cited by applicant]
US 10232018B2 · Knight et al. · 2019 [cited by applicant]
US 10286041B2 · Cartt · 2019 [cited by applicant]
US 11752199B1 · Wright · 2023 [cited by applicant]
US 11975047B1 · DeSimone, III · 2024 [cited by applicant]
US 12102662B1 · DeSimone, III · 2024 [cited by applicant]
US 12133831B1 · DeSimone, III · 2024 [cited by applicant]
US 12233105B1 · DeSimone, III · 2025 [cited by applicant]
US 12324787B1 · DeSimone, III · 2025 [cited by applicant]
US 20070054957A1 · Upadhyay · 2007 [cited by applicant]
US 20090060868A1 · Brod · 2009 [cited by examiner]
US 20090216212A1 · Fangrow, Jr. · 2009 [cited by applicant]
US 20140294923A1 · Cartt et al. · 2014 [cited by applicant]
US 20180161243A1 · Ariagno · 2018 [cited by applicant]
US 20180250365A1 · Somera-Molina · 2018 [cited by applicant]
US 20190160150A1 · Knight et al. · 2019 [cited by applicant]
US 20190216901A1 · Cartt et al. · 2019 [cited by applicant]
US 20210100878A1 · Lallo et al. · 2021 [cited by applicant]
US 20210322520A1 · Wright · 2021 [cited by applicant]
US 20220031611A1 · Bansal · 2022 [cited by applicant]
US 20220054595A1 · Lallo et al. · 2022 [cited by applicant]
US 20220111012A1 · Wright et al. · 2022 [cited by applicant]
US 20220133595A1 · Miksztal · 2022 [cited by applicant]
US 20230165946A1 · Rhee · 2023 [cited by applicant]
US 20240042135A1 · O'Neill et al. · 2024 [cited by applicant]
WO 2020150738A1 · 2020 [cited by applicant]
WO 2022131919A1 · 2022 [cited by applicant]
WO 2023034819A1 · 2023 [cited by applicant]
Mallinckrodt, ACTHAR—repository corticotropin injection, Injection Instructions; ARDUS/01-13/0417/0033, 2021. [cited by examiner]
Mallinckrodt, Acthar gel vial label , repository corticotrophin injection, Injection Instructions; ARDUS/01-13/0417/0033, 2016. [cited by examiner]
Acthar Gel, repository corticotropin injection. Package Insert. Mallinckrodt ARD. U.S. Food and Drug Administration website. https://www. accessdata. fda. gov /drugsatfda_ docs/label/2021 /008372s068l bl. pdf ( Revised … [cited by applicant]
Riniker et al. Revised amino-acid sequences for porcine and human adrenocorticotrophic hormone. Nat New Biol. Jan. 26, 1972;235(56): 114-5. [cited by applicant]
Office Action dated Oct. 16, 2024 issued in U.S. Appl. No. 18/818,974. (24 pages). [cited by applicant]
Mallinckrodt (ACTHAR—repository corticotropin injection, Injection Instructions; ARDUS/01-13/0417/0033, 2017. [cited by applicant]
Mallinckrodt Label—NIH/DailyMed. Drug Archives, 2016 label. [cited by applicant]
Citron Reports Further Results from Laboratory Testing: Questcor is Deceiving the FDA and Investors, H.P. Acthar Gel's Specified Active Ingredient Less Than 20% of the Label Specification, Bioactivity of Deamidated Horm… [cited by applicant]
Acthar Gel (repository corticotropin injection), Package Insert, Mallinckrodt ARD LLC, 2021, 22 pgs. [cited by applicant]
Repository Corticotropin (H.P. Acthar Gel), BlueCross BlueShield of North Carolina, 2012, 5 pgs. [cited by applicant]
Purified Cortrophin(R) Gel Repository Corticotropin Injection U.S.P., Organon Inc., (1972), 3 pgs. [cited by applicant]
USP, Notice of Intent to Revise :<660> Container Glass, (Year:2023) (2 pages). [cited by applicant]
Office Action issued in U.S. Appl. No. 18/495,932 dated Jan. 11, 2024 (27 pages). [cited by applicant]
Office Action issued in U.S. Appl. No. 18/496,170 dated Sep. 25, 2024 (13 pages). [cited by applicant]
Wallace I, Cunningham S, Lindsay J. The diagnosis and investigation of adrenal insufficiency in adults. Ann Clin Biochem. Sep. 2009;46(Pt 5):351-67. (Year: 2009) 17 pgs. [cited by applicant]
Office Action dated Mar. 13, 2024 issued in corresponding U.S. Appl. No. 18/496,150 (9 pages). [cited by applicant]
Mallinckrodt, Acthar: Step-by-Step Self-Injection Instructions (repository corticotropin injection), 2017 (28 pages). [cited by applicant]
Mallinckrodt Label—NIH/DailyMed. Drug Archives, 2016 label (18 pages). [cited by applicant]
Office Action dated Jan. 13, 2026 issued in U.S. Appl. No. 19/029,422. (50 pages). [cited by applicant]
Simsarian et al. Five-day regimen of intramuscular or subcutaneous self-administered adrenocorticotropic hormone gel for acute exacerbations of multiple sclerosis: a prospective, randomized, open-label pilot trial. Abst… [cited by applicant]
Schwarz, K. The question of adrenocortical function in thyroid affections. I. Hyperthyroidism and thyrotoxic crises. [Zur frage der nebennierenrinden-funktion bei erkrankungen der schilddruse. I. Hyperthyreosen und thyr… [cited by applicant]
Office Action dated May 8, 2026 issued in U.S. Appl. No. 19/029,422 (29 pages). [cited by applicant]