IP Library › Granted Patent US 12,297,250
Granted Patent B2
US 12,297,250 · App. 17/298,512 · Granted May 13, 2025

Modified GIP peptide analogues

Inventors: Alexander Hovard Sparre-Ulrich (Copenhagen N, DK); Bjørn Behrens Sivertsen (Copenhagen S, DK); Ditte Riber (Brønshøj, DK); Mette Marie Rosenkilde (Hellerup, DK)
Assignee: ANTAG THERAPEUTICS APS
C07K14/605A61K38/22C07K14/645A61K38/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,297,250
App. No.
17/298,512
Granted
May 13, 2025
Kind
B2
Abstract

Disclosed are glucose-dependent insulinotropic peptide (GIP)-derived peptide analogues which are antagonists of the GIP receptor. These GIP peptide analogues are modified by comprising one or more individual amino acid substitutions and are fatty acid conjugated with/without a linker, so to have improved antagonistic activity and improved pharmacokinetic profile.

Claims (45)

1. A glucose-dependent insulinotropic peptide (GIP) analogue consisting of the amino acid sequence of SEQ ID NO: 81:

(SEQ ID NO: 81)

3   4   5   6   7   8   9   10  11  12  13    14  15  16  17

E - G - T - F - I - S - E - Y - S - I - Aib - L - E - K - I

18  19  20  21  22  23  24  25  26  27  28  29  30

K - Q - Q - E - F - V - E - W - L - L - A - Q - K - Z,

wherein said amino acid sequence is modified by attaching a fatty acid molecule at one or more amino acid residue, directly or via a linker, at any one of positions 3 to 29 of SEQ ID NO: 81,

wherein Z is a peptide of one or more amino acid residues of GIP(31-42) (GKKNDWKHNITQ; SEQ ID NO: 2) or wherein Z is a peptide of one or more amino acid residues of Exendin-4 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; SEQ ID NO: 3),

wherein said amino acid sequence is optionally C-terminally amidated (—NH2) or C-terminally carboxylated (—COOH), and

wherein said GIP analogue is an antagonist of GIPR.

2. The GIP analogue according to claim 1 ,

wherein said GIP analogue inhibits GIPR activity of at least 80%, and/or

wherein inhibition of GIPR activity is determined as a decrease in intracellular cAMP, and/or

wherein said GIP analogue has a GIPR antagonistic potency corresponding to an IC50 value of 50 nM or less than 50 nM.

3. The GIP analogue according to claim 1 , wherein Z consists of one or more consecutive amino acid residues of:

(a) the C-terminus of Exendin-4(30-39) (PSSGAPPPS; SEQ ID NO: 4; CE31-39); or

(b) the C-terminus of Exendin-4(29-39) (GPSSGAPPPS; SEQ ID NO: 5; CE30-39).

4. The GIP analogue according to claim 1 , wherein Z is a peptide selected from:

a glycine, a proline, GP, PS, PSS, GPS, GPSS (SEQ ID NO: 6), PSSG (SEQ ID NO: 12), PSSGA (SEQ ID NO: 13), GPSSG (SEQ ID NO: 7), GPSSGA (SEQ ID NO: 8), PSSGAP (SEQ ID NO: 14), PSSGAPP (SEQ ID NO: 15), GPSSGAP (SEQ ID NO: 9), GPSSGAPP (SEQ ID NO: 10), PSSGAPPP (SEQ ID NO: 16), PSSGAPPPS (SEQ ID NO: 4), GPSSGAPPP (SEQ ID NO: 11), GPSSGAPPPS (SEQ ID NO: 5),

GK, GKK, GKKN (SEQ ID NO: 17), GKKND (SEQ ID NO: 18), GKKNDW (SEQ ID NO: 19), GRKNDW (SEQ ID NO: 20), GKRNDW (SEQ ID NO: 21), GRRNDW (SEQ ID NO: 22), GKKKDW (SEQ ID NO: 28), GKKNDK (SEQ ID NO: 29), GKKNDWK (SEQ ID NO: 23), GKKNDWKH (SEQ ID NO: 24), GKKNDWKHN (SEQ ID NO: 25), GKKNDWKHNI (SEQ ID NO: 26), GKKNDWKHNIT (SEQ ID NO: 27), and GKKNDWKHNITQ (SEQ ID NO: 2).

5. The GIP analogue according to claim 1 , wherein said fatty acid molecule is attached to an amino acid residue at any one of positions 11 to 21 of SEQ ID NO: 81.

6. The GIP analogue according to claim 1 , wherein a fatty acid molecule is attached to the side chain amino group of the K amino acid residue at position 18 of SEQ ID NO: 81.

7. The GIP analogue according to claim 1 , wherein said GIP analogue peptide is C-terminally amidated (−NH 2 ) or C-terminally carboxylated (—COOH).

8. The GIP analogue according to claim 1 , wherein said fatty acid molecule is a straight-chain fatty acid or a branched fatty acid.

9. The GIP analogue according to claim 1 , wherein:

a) said fatty acid molecule is a monoacyl fatty acid molecule comprising one fatty acid;

b) said fatty acid molecule is a diacyl fatty acid molecule;

c) said fatty acid molecule comprises an acyl group of the formula CH 3 (CH 2 ) n CO—, wherein n is in an integer of 4 to 24; or

d) said fatty acid molecule comprises an acyl group selected from COOH(CH 2 ) 14 CO—, COOH(CH 2 ) 16 CO—, COOH(CH 2 ) 18 CO— and COOH(CH 2 ) 20 CO—.

10. The GIP analogue according to claim 1 , wherein said GIP analogue is modified by attaching a fatty acid molecule at an amino acid residue via a linker, wherein said linker comprises one or more moieties individually selected from:

a) α-amino acid, γ-amino acid, and ω-amino acid;

b) one or more amino acids selected from Lys, Glu, and Asp;

c) one or more of γ-aminobutanoyl (γ-aminobutyric acid), γ-Glu (γ-glutamic acid), β-Asp (β-asparagyl), β-Ala (β-alanyl) and Gly;

d) [8-amino-3,6-dioxaoctanoic acid] n (AEEAc n ), wherein n is an integer of 1 to 50, or an integer of 1-4, 1-3, or 1-2; and

(e) succinic acid.

11. The GIP analogue according to claim 1 , wherein the GIP analogue is

EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 174 GIP(3-30)+Cex(31-39).

12. The GIP analogue according to claim 1 , wherein said GIP analogue is

EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 174 GIP(3-30)+Cex(31-39).

13. The GIP analogue according to claim 1 , wherein said GIP analogue is EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 174 GIP(3-30)+Cex(31-39), wherein said GIP analogue is C-terminally carboxylated.

14. The GIP analogue according to claim 1 , wherein said GIP analogue is EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 174 GIP(3-30)+Cex(31-39), wherein said GIP analogue is C-terminally amidated.

15. A method of treating obesity in a subject, wherein said method comprises administering to the subject the GIP analogue

EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 174 GIP(3-30)+Cex(31-39), wherein said GIP analogue is C-terminally carboxylated.

16. A method of reducing one or more of i) GIP-induced glucagon secretion, ii) GIP-induced insulin secretion, iii) GIP-induced somatostatin secretion, iv) GIP-induced glucose uptake, and v) GIP-induced leptin resistance in a subject, wherein said method comprising administering a GIP analogue according to claim 1 to the subject.

17. A method of treating a condition in a subject, wherein said method comprises administering a GIP analogue according to claim 1 to the subject, wherein the condition is selected from the group consisting of obesity, pre-diabetes, type 2 diabetes, insulin resistance, elevated fasting glucose, and hyperglycemia.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded May 28, 2021
From: SPARRE-ULRICH, ALEXANDER HOVARD; SIVERTSEN, BJØRN BEHRENS; RIBER, DITTE; ROSENKILDE, METTE MARIE
To: ANTAG THERAPEUTICS APS
Reel/Frame 056389/0416 →
Priority Claims (2)
EP 18209896 · Dec 3, 2018 · regional
EP 19176739 · May 27, 2019 · regional
Continuity (1)
Related Publication 20220298218A1 · Sep 22, 2022
References Cited (119)
US 6004297A · Steenfeldt-Jensen et al. · 1999 [cited by applicant]
US 6268343B1 · Knudsen et al. · 2001 [cited by applicant]
US 6384016B1 · Kaarsholm · 2002 [cited by applicant]
US 6410508B1 · Isales et al. · 2002 [cited by applicant]
US 6458924B2 · Knudsen et al. · 2002 [cited by applicant]
US 7326688B2 · O'Harte et al. · 2008 [cited by applicant]
US 7875587B2 · Gault et al. · 2011 [cited by applicant]
US 8450266B2 · Dong et al. · 2013 [cited by applicant]
US 9072703B2 · Dong · 2015 [cited by applicant]
US 10774127B2 · Hartmann et al. · 2020 [cited by applicant]
US 11572399B2 · Rosenkilde · 2023 [cited by examiner]
US 20010011071A1 · Knudsen et al. · 2001 [cited by applicant]
US 20050272652A1 · Gault et al. · 2005 [cited by applicant]
US 20070167370A1 · Gault et al. · 2007 [cited by applicant]
US 20080009603A1 · Gault et al. · 2008 [cited by applicant]
US 20080312157A1 · Levy et al. · 2008 [cited by applicant]
US 20190330332A1 · Okahara et al. · 2019 [cited by applicant]
US 20190330333A1 · Okahara et al. · 2019 [cited by applicant]
US 20190330334A1 · Okahara et al. · 2019 [cited by applicant]
EP 3560514A1 · 2019 [cited by applicant]
EP 3560515A1 · 2019 [cited by applicant]
EP 3569248A1 · 2019 [cited by applicant]
WO WO199629342A1 · 1996 [cited by applicant]
WO WO199808871A1 · 1998 [cited by applicant]
WO WO199824464A1 · 1998 [cited by applicant]
WO WO9943708A1 · 1999 [cited by applicant]
WO WO200034331A2 · 2000 [cited by applicant]
WO WO200058360A2 · 2000 [cited by applicant]
WO WO200246227A2 · 2002 [cited by applicant]
WO WO2003082898A2 · 2003 [cited by applicant]
WO WO2004067548A2 · 2004 [cited by applicant]
WO WO2005082928A2 · 2005 [cited by applicant]
WO WO2006086769A2 · 2006 [cited by applicant]
WO WO2006097537A2 · 2006 [cited by applicant]
WO WO2007109354A2 · 2007 [cited by applicant]
WO WO2010016935A2 · 2010 [cited by applicant]
WO WO2010016936A1 · 2010 [cited by applicant]
WO WO2010016938A2 · 2010 [cited by applicant]
WO WO2010016940A2 · 2010 [cited by applicant]
WO WO2010016944A2 · 2010 [cited by applicant]
WO WO2012055770A1 · 2012 [cited by applicant]
WO WO2012088379A2 · 2012 [cited by applicant]
WO WO2012167744A1 · 2012 [cited by applicant]
WO WO2016034186A1 · 2016 [cited by applicant]
WO WO2016066744 · 2016 [cited by applicant]
WO WO2016066744A2 · 2016 [cited by applicant]
WO WO2016205488A1 · 2016 [cited by applicant]
WO WO2018220123A1 · 2018 [cited by applicant]
WO WO200020592A1 · 2020 [cited by applicant]
Bech, et al., ACS Med. Chem. Lett. 9:577-580 (first published online Jun. 2018) (Year: 2018). [cited by examiner]
Coskun T. et al.: “LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus: From discovery to clinical proof of concept”; Mol. Metab., 2018 (OT 03.10.2018), v. 18: 3-14; doi:… [cited by applicant]
Frias J.P. et al., “Efficacy and safety of LY3298176, a novel dual GIP and GLP-1 receptor agonist, inpa tients with type 2 diabetes: a randomised, placebo- controlled and active comparator-controlled phase2 trial”, Lanc… [cited by applicant]
Green B. D. & Flatt P.R.: “Incretin hormone mimetics and analogues in diabetes therapeutics”, Best Practice & Research Clinical Endocrinology & Metabolism, 2007, v. 21 (4): 497-516, doi: 10.1016/j.beem.2007.09.003, abst… [cited by applicant]
Knudsen L.B. et al.: “Small-molecule agonists for the glucagon-likepeptide 1 receptor”, PNAS, 2007, v. 104(3): 937-942, doi: 10.1073/pnas.0605701104, abstract, cpd1-2. [cited by applicant]
Sha Y. et al.: “Cochinchinenin C, a potential nonpolypeptide anti-diabetic drug, targets a glucagon-like peptide-1 receptor”, RSC Adv., 2017, v. 7: 49015-49023, DOI: 10.1039/c7ra09470a, abstract, fig. 1. [cited by applicant]
Seino Y. et al.: “Glucose-dependent insulinotropic polypeptide and glucagon-like peptide-1: Incretin actions beyond the pancreas”—Journal of Diabetes Investigation, 2013, v. 4(2): 108-130. [cited by applicant]
Adrian TE, Bloom SR, Hermansen K, Iversen J. Pancreatic polypeptide, glucagon and insulin secretion from the isolated perfused canine pancreas. Diabetologia;14(6):413-417, 1978. [cited by applicant]
Ahlqvist E, Osmark P, Kuulasmaa T et al. Link Between GIP and Osteopontin in Adipose Tissue and Insulin Resistance. Diabetes;62(6):2088-2094, 2013. [cited by applicant]
Asmar M, Simonsen L, Madsbad S, Stallknecht B, Holst JJ, B++low J. Glucose-Dependent Insulinotropic Polypeptide May Enhance Fatty Acid Re-esterification in Subcutaneous Abdominal Adipose Tissue in Lean Humans. Diabetes;… [cited by applicant]
Baggio LL, Drucker DJ. Biology of Incretins: GLP-1 and GIP. Gastroenterology;132(6):2131-2157, 2007. [cited by applicant]
Brunicardi FC, Druck P, Seymour NE, Sun YS, Elahi D, Andersen DK. Selective neurohormonal interactions in islet cell secretion in the isolated perfused human pancreas. Journal of Surgical Research;48(4):273-278, 1990. [cited by applicant]
Brons C, Jensen CB, Storgaard H et al. Impact of short-term high-fat feeding on glucose and insulin metabolism in young healthy men. The Journal of Physiology; 587(10):2387-2397, 2009. [cited by applicant]
Calanna S, Christensen M, Holst JJ et al. Secretion of Glucose-Dependent Insulinotropic Polypeptide in Patients With Type 2 Diabetes: Systematic review and meta-analysis of clinical studies. Diabetes Care; 36(10):3346-3… [cited by applicant]
Christensen M, Calanna S, Sparre-Ulrich AH et al. Glucose-Dependent Insulinotropic Polypeptide Augments Glucagon Responses to Hypoglycemia in Type 1 Diabetes. Diabetes 64(1):72-78 ( Jan. 2015, e-published Jul. 22, 2014). [cited by applicant]
Christensen M, Vedtofte L, Holst JJ, Vilsboell T, Knop FK. Glucose-Dependent Insulinotropic Polypeptide: A Bifunctional Glucose-Dependent Regulator of Glucagon and Insulin Secretion in Humans. Diabetes; 60(12):3103-3109… [cited by applicant]
Christensen MB, Calanna S, Holst JJ, Vilsboell T, Knop FK. Glucose-dependent Insulinotropic Polypeptide: Blood Glucose Stabilizing Effects in Patients With Type 2 Diabetes. The Journal of Clinical Endocrinology & Metabo… [cited by applicant]
Deacon CFP. GIP-(3-42) does not antagonize insulinotropic effects of GIP at physiological concentrations. American Journal of Physiology—Endocrinology and Metabolism;291(3):E468-E475, 2006. [cited by applicant]
DeBlasi A, O'Reilly K, Motulsky HJ. Calculating receptor No. from binding experiments using same compound as radioligand and competitor. Trends in pharmacological sciences.;10(6):227-9, 1989. [cited by applicant]
Deschamps I, Heptner W, Desjeux JF, Baltakse V, Machinot S, Lestradet H. Effects of diet on insulin and gastric inhibitory polypeptide levels in obese children. Pediatr Res; 14(4 Pt 1):300-303, 1980. [cited by applicant]
Ding WG, Renstrom E, Rorsman P, Buschard K, Gromada J. Glucagon-like peptide I and glucose-dependent insulinotropic polypeptide stimulate Ca2+-induced secretion in rat alpha-cells by a protein kinase A—mediated mechanis… [cited by applicant]
Dupre J, Caussignac Y, McDonald TJ, Van Vliet S. Stimulation of Glucagon Secretion by Gastric Inhibitory Polypeptide in Patients with Hepatic Cirrhosis and Hyperglucagonemia. The Journal of Clinical Endocrinology & Meta… [cited by applicant]
Ebert R, Illmer K, Creutzfeldt W. Release of gastric inhibitory polypeptide (GIP) by intraduodenal acidification in rats and humans and abolishment of the incretin effect of acid by GIP-antiserum in rats. Gastroenterolo… [cited by applicant]
Fujita Y, Asadi A, Yang GK, Kwok YN, Kieffer TJ. Differential processing of pro-glucose-dependent insulinotropic polypeptide in gut. American Journal of Physiology—Gastrointestinal and Liver Physiology.;298(5):G608-G614… [cited by applicant]
Fulurija A, Lutz TA, Sladko K et al. Vaccination against GIP for the Treatment of Obesity. PLoS ONE; 3(9):e3163, 2008. [cited by applicant]
Gault et al: Evidence that the major degradation product of glucose-dependent insulinotropic polypeptide, GIP (3-42) . . . ; J. Endocrinology; 175; 525-533, 2002. [cited by applicant]
Gault VA, Hunter K, Irwin N, Green BD, Harriott P, O'Harte FPM, Flatt PR. Characterization and biological activity of Glu3 amino acid substituted GIP receptor antagonists. Archives of Biochemistry and Biophysics 2007:46… [cited by applicant]
Gault VA, O'Harte FPM, Harriott P, Flatt PR. Characterization of the Cellular and Metabolic Effects of a Novel Enzyme-Resistant Antagonist of Glucose-Dependent Insulinotropic Polypeptide. Biochemical and Biophysical Res… [cited by applicant]
Gelling RW, Coy DH, Pederson RA et al. GIP(6-30amide) contains the high affinity binding region of GIP and is a potent inhibitor of GIP1-42 action in vitro. Regulatory Peptides; 69(3):151-154, 1997. [cited by applicant]
Getty-Kaushik L, Song DH, Boylan MO, Corkey BE, Wolfe MM. Glucose-Dependent Insulinotropic Polypeptide Modulates Adipocyte Lipolysis and Reesterification. Obesity;14(7):1124-1131, 2006. [cited by applicant]
Goetze JP, Hunter I, Lippert SK, Bardram L, Rehfeld JF. Processing-independent analysis of peptide hormones and prohormones in plasma. Front Biosci; 17:1804-15, 2012. [cited by applicant]
Goetze JP, Rehfeld JF. Peptide hormones and their prohormones as biomarkers. Biomarkers in Medicine; Aug. 1, 2009: Future Medicine; p. 335-8, 2009. [cited by applicant]
Graham FL, van der Eb AJ. A new technique for the assay of infectivity of human adenovirus 5 DNA. Virology;52(2):456-467, 1973. [cited by applicant]
Gutniak M, Orkov C, Holst JJ, Ahrén B, Efendi-ç S. Antidiabetogenic Effect of Glucagon-like Peptide-1 (7-36)amide in Normal Subjects and Patients with Diabetes Mellitus. N Engl J Med;326(20):1316-1322, 1992. [cited by applicant]
Hansen et al; “N-terminally and C-terminally truncated forms . . . ”; British J.of Pharmacology; vol. 173; pp. 826-838, 2016. [cited by applicant]
Hauner H, Glatting G, Kaminska D, Pfeiffer EF. Effects of gastric inhibitory polypeptide on glucose and lipid metabolism of isolated rat adipocytes. Ann Nutr Metab;32(5-6):282-288, 1988. [cited by applicant]
Heer J, Rasmussen C, Coy DH, Holst JJ. Glucagon-like peptide-1, but not glucose-dependent insulinotropic peptide, inhibits glucagon secretion via somatostatin (receptor subtype 2) in the perfused rat pancreas. Diabetolo… [cited by applicant]
Hinke SA, Gelling R, Manhart S, Lynn F, Pederson RA, Kühn-Wache K, et al. Structure-Activity Relationships of Glucose-Dependent Insulinotropic Polypeptide (GIP). bchm Biological Chemistry, p. 403, 2003. [cited by applicant]
Hinke SA, Manhart S, Pamir N et al. Identification of a bioactive domain in the amino-terminus of glucose-dependent insulinotropic polypeptide (GIP) . Biochimica et Biophysica Acta (BBA)—Protein Structure and Molecular … [cited by applicant]
Hinke SA, Manhart S, Speck M, Pederson RA, Demuth HU, McIntosh CHS. In depth analysis of the N-terminal bioactive domain of gastric inhibitory polypeptide. Life Sciences; 75(15):1857-70, 2004. [cited by applicant]
Hoejberg PV, Vilsboell T, Raboel R, Knop FK, Bache M, Krarup T, et al. Four weeks of near-normalisation of blood glucose improves the insulin response to glucagon-like peptide-1 and glucose-dependent insulinotropic poly… [cited by applicant]
Holst JJ, Bersani M. 1—Assays for Peptide Products of Somatostatin Gene Expression. In: Conn PM, editor. Methods in Neurosciences. vol. 5: Academic Press; . p. 3-22, 1991. [cited by applicant]
Holst JJ. On the Physiology of GIP and GLP-1. Horm Metab Res;36(11/12):747-754, 2004. [cited by applicant]
Irwin N, Green BD, Parker JC, Gault VA, O'Harte FPM, Flatt PR. Biological activity and antidiabetic potential of synthetic fragment peptides of glucose-dependent insulinotropic polypeptide, GIP (1-16) and (Pro3) GIP(1-1… [cited by applicant]
Irwin N, McClean PL, Patterson S, Hunter K, Flatt PR. Active immunisation against gastric inhibitory polypeptide (GIP) improves blood glucose control in an animal model of obesity-diabetes. Biological Chemistry. bchm 39… [cited by applicant]
Irwin, N. et al.: “GIP (Lys 16PAL) and GIP (Lys 37 PAL) : Novel Long-Acting Acylated Analogues of Glucose-Dependent Insulinotropic Polypeptide with Improved Antidiabetic Potential”, Journal of Medicinal Chemistry, vol. … [cited by applicant]
Jørgensen NB, Dirksen C, Bojsen-Møller KN et al. Exaggerated Glucagon-Like Peptide 1 Response is Important for Improved β-Cell Function and Glucose Tolerance After Roux-en-Y Gastric Bypass in Patients With Type 2 Diabet… [cited by applicant]
Kerr, B.D. et al. (Jan. 21, 2011, e-published Dec. 22, 2010). “Characterization and biological actions of N-terminal truncated forms of glucose-dependent insulinotropic polypeptide,” Biochem Biophys Res Commun vol. 404,… [cited by applicant]
Kim SJ, Nian C, Karunakaran S, Clee SM, Isales CM, McIntosh CHS. GIP-Overexpressing Mice Demonstrate Reduced Diet-Induced Obesity and Steatosis, and Improved Glucose Homeostasis. PLoS ONE; 7(7):e40156, 2012. [cited by applicant]
Kissow H, Hartmann B, Holst JJ et al. Glucagon-like peptide-1 (GLP-1) receptor agonism or DPP-4 inhibition does not accelerate neoplasia in carcinogen treated mice. Regulatory Peptides;179(1-3):91 -100, 2012. [cited by applicant]
Lazareno S, Birdsall NJ. Estimation of competitive antagonist affinity from functional inhibition curves using the Gaddum, Schild and Cheng-Prusoff equations. British journal of pharmacology; 109(4):1110-9, 1993. [cited by applicant]
Martin CM, Irwin N, Flatt PR, Gault Va. A novel acylated form of (d-Ala(2))GIP with improved antidiabetic potential, lacking effect on body fat stores. Biochimica et biophysica acta.; 1830(6):3407-13, 2013. [cited by applicant]
Meier JJ, Gallwitz B, Siepmann N et al. Gastric inhibitory polypeptide (GIP) dose-dependently stimulates glucagon secretion in healthy human subjects at euglycaemia. Diabetologia;46(6):798-801, 2003. [cited by applicant]
Miyawaki K, Yamada Y, Ban N et al. Inhibition of gastric inhibitory polypeptide signaling prevents obesity. Nat Med;8(7):738-742, 2002. [cited by applicant]
Miyawaki K, Yamada Y, Yano H et al. Glucose intolerance caused by a defect in the entero-insular axis: A study in gastric inhibitory polypeptide receptor knockout mice. Proceedings of the National Academy of Sciences;96… [cited by applicant]
Nakamura T, Tanimoto H, Mizuno Y, Tsubamoto Y, Noda H. Biological and functional characteristics of a novel low-molecular weight antagonist of glucose-dependent insulinotropic polypeptide receptor, SKL-14959, in vitro a… [cited by applicant]
Nasteska D, Harada N, Suzuki K et al. Chronic Reduction of GIP Secretion Alleviates Obesity and Insulin Resistance Under High-Fat Diet Conditions. Diabetes; 63(7):2332-2343, 2014. [cited by applicant]
Pathak V, Gault VA, Flatt PR, Irwin N. Antagonism of gastric inhibitory polypeptide (GIP) by palmitoylation of GIP analogues with N- and C-terminal modifications improves obesity and metabolic control in high fat fed mi… [cited by applicant]
Pathak, V. et al.: “Sequential induction of beta cell rest and stimulation using stable GIP inhibitor and GLP-1 mimetic peptides improves metabolic control in C57BL/KsJdb/dbmice”, Diabetologica, vol. 58, No. 9, 2015. [cited by applicant]
Pederson R, Brown J. Interaction of Gastric Inhibitory Polypeptide, Glucose, and Arginine on Insulin and Glucagon Secretion from the Perfused Rat Pancreas. Endocrinology; 103(2):610-615, 1978. [cited by applicant]
Perryra, Craig SL, Ng MT, Gault VA, Flatt PR, Irwin N. Characterization of glucose-dependent insulinotropic polypeptide receptor antagonists in rodent pancreatic beta cells and mice. Clinical Medicine Insights: Endocrin… [cited by applicant]
Raufman JP, Singh L, Eng J. Exendin-3, a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. De… [cited by applicant]
Ravn P, Madhurantakam C, Kunze S et al. Structural and Pharmacological Characterization of Novel Potent and Selective Monoclonal Antibody Antagonists of Glucose-dependent Insulinotropic Polypeptide Receptor. Journal of … [cited by applicant]
Rosenkilde MM, Cahir M, Gether U, Hjorth SA, Schwartz TW. Mutations along transmembrane segment II of the NK-1 receptor affect substance P competition with non-peptide antagonists but not substance P binding. Journal of… [cited by applicant]
Sauber J, Grothe J, Behm M, Scherag A, Grallert H, Illig T, et al. Association of variants in gastric inhibitory polypeptide receptor gene with impaired glucose homeostasis in obese children and adolescents from Berlin.… [cited by applicant]
Song DH, Getty-Kaushik L, Tseng E, Simon J, Corkey BE, Wolfe MM. Glucose-Dependent Insulinotropic Polypeptide Enhances Adipocyte Development and Glucose Uptake in Part Through Akt Activation. Gastroenterology;133(6):179… [cited by applicant]
Sparre-Ulrich, A.H. et al. (May 1, 2017, e-published Feb. 22, 2017). “GIP (3-30) NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin relea… [cited by applicant]
Starich GH, Bar RS, Mazzaferri El. Gip increases insulin receptor affinity and cellular sensitivity in adipocytes. Am J Physiol; 249(6 Pt 1):E603-E607, 1985. [cited by applicant]
Tseng CC, Kieffer TJ, Jarboe LA, Usdin TB, Wolfe MM. Postprandial stimulation of insulin release by glucose-dependent insulinotropic polypeptide (GIP). Effect of a specific glucose-dependent insulinotropic polypeptide r… [cited by applicant]
Widenmaier SB, Kim SJ, Yang GK, De Los Reyes T, Nian C, Asadi A, et al. A GIP Receptor Agonist Exhibits beta-Cell Anti-Apoptotic Actions in Rat Models of Diabetes Resulting in Improved beta-Cell Function and Glycemic Co… [cited by applicant]